Samia BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0005_H15
         (664 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF040653-6|AAB95032.1|  508|Caenorhabditis elegans F-box b prote...    31   0.96 
U28735-3|AAF99958.3|  467|Caenorhabditis elegans Glycosylation r...    27   9.0  
U28735-2|AAM69111.1|  543|Caenorhabditis elegans Glycosylation r...    27   9.0  
AF082011-1|AAD03023.1|  467|Caenorhabditis elegans UDP-N-acetylg...    27   9.0  

>AF040653-6|AAB95032.1|  508|Caenorhabditis elegans F-box b protein
           protein 51 protein.
          Length = 508

 Score = 30.7 bits (66), Expect = 0.96
 Identities = 18/43 (41%), Positives = 22/43 (51%)
 Frame = -2

Query: 129 NLKNWLKDRFYSFILRSSSLNPFF*LTFTEFFSKFKIQILKCS 1
           NLKNWLK   Y  I  SS ++      F E F K +  +LK S
Sbjct: 385 NLKNWLKQLLY--IFGSSKIDSVEFFRFDEEFQKTQFHVLKDS 425


>U28735-3|AAF99958.3|  467|Caenorhabditis elegans Glycosylation
           related protein 12,isoform a protein.
          Length = 467

 Score = 27.5 bits (58), Expect = 9.0
 Identities = 7/13 (53%), Positives = 12/13 (92%)
 Frame = -2

Query: 153 YNYKVLYSNLKNW 115
           YNYK++Y N+++W
Sbjct: 345 YNYKIVYKNIRDW 357


>U28735-2|AAM69111.1|  543|Caenorhabditis elegans Glycosylation
           related protein 12,isoform b protein.
          Length = 543

 Score = 27.5 bits (58), Expect = 9.0
 Identities = 7/13 (53%), Positives = 12/13 (92%)
 Frame = -2

Query: 153 YNYKVLYSNLKNW 115
           YNYK++Y N+++W
Sbjct: 345 YNYKIVYKNIRDW 357


>AF082011-1|AAD03023.1|  467|Caenorhabditis elegans
           UDP-N-acetylglucosamine:a-3-D-mannosideb-1,
           2-N-acetylglucosaminyltransferase I protein.
          Length = 467

 Score = 27.5 bits (58), Expect = 9.0
 Identities = 7/13 (53%), Positives = 12/13 (92%)
 Frame = -2

Query: 153 YNYKVLYSNLKNW 115
           YNYK++Y N+++W
Sbjct: 345 YNYKIVYKNIRDW 357


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,427,219
Number of Sequences: 27780
Number of extensions: 290438
Number of successful extensions: 778
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 764
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 778
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1486926498
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)