SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0004_P12
         (407 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY028784-1|AAK32958.2|  499|Anopheles gambiae cytochrome P450 pr...    23   4.3  
AJ304412-1|CAC39105.1|  196|Anopheles gambiae dynamin protein.         23   4.3  
Y13592-1|CAA73920.1|  136|Anopheles gambiae voltage-gated sodium...    22   9.9  
DQ263748-1|ABB84470.1|   78|Anopheles gambiae para-type sodium c...    22   9.9  
DQ022109-1|AAY51997.1|   66|Anopheles gambiae voltage-gated sodi...    22   9.9  
DQ022108-1|AAY51996.1|   66|Anopheles gambiae voltage-gated sodi...    22   9.9  
AY615653-1|AAU05110.1|   71|Anopheles gambiae sodium channel pro...    22   9.9  
AY615652-1|AAU05109.1|   71|Anopheles gambiae sodium channel pro...    22   9.9  
AY615651-1|AAU05108.1|   71|Anopheles gambiae sodium channel pro...    22   9.9  
AY615650-1|AAU05107.1|   62|Anopheles gambiae sodium channel pro...    22   9.9  
AY615649-1|AAU05106.1|   71|Anopheles gambiae sodium channel pro...    22   9.9  
AY615648-1|AAU05105.1|   71|Anopheles gambiae sodium channel pro...    22   9.9  
AY615647-1|AAU05104.1|   71|Anopheles gambiae sodium channel pro...    22   9.9  
AY615646-1|AAU05103.1|   71|Anopheles gambiae sodium channel pro...    22   9.9  
AY615628-1|AAU05085.1|   71|Anopheles gambiae sodium channel pro...    22   9.9  
AY615618-1|AAU05075.1|   71|Anopheles gambiae sodium channel pro...    22   9.9  
AY615617-1|AAU05074.1|   71|Anopheles gambiae sodium channel pro...    22   9.9  
AY615616-1|AAU05073.1|   71|Anopheles gambiae sodium channel pro...    22   9.9  
AY615615-1|AAU05072.1|   69|Anopheles gambiae sodium channel pro...    22   9.9  
AY615614-1|AAU05071.1|   71|Anopheles gambiae sodium channel pro...    22   9.9  
AY615612-1|AAU05069.1|   69|Anopheles gambiae sodium channel pro...    22   9.9  
AY615610-1|AAU05067.1|   71|Anopheles gambiae sodium channel pro...    22   9.9  
AY615609-1|AAU05066.1|   71|Anopheles gambiae sodium channel pro...    22   9.9  
AY615608-1|AAU05065.1|   71|Anopheles gambiae sodium channel pro...    22   9.9  
AY615571-1|AAU05028.1|   62|Anopheles gambiae sodium channel pro...    22   9.9  
AY615570-1|AAU05027.1|   71|Anopheles gambiae sodium channel pro...    22   9.9  
AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi...    22   9.9  

>AY028784-1|AAK32958.2|  499|Anopheles gambiae cytochrome P450
           protein.
          Length = 499

 Score = 23.0 bits (47), Expect = 4.3
 Identities = 12/30 (40%), Positives = 16/30 (53%)
 Frame = +3

Query: 141 KPTVSKTEIREKLAKMYKVTPDVVFVFGFK 230
           KPT+    I EKL K  K   D V ++ F+
Sbjct: 49  KPTIHFAYIIEKLYKRLKSKGDYVGIYFFR 78


>AJ304412-1|CAC39105.1|  196|Anopheles gambiae dynamin protein.
          Length = 196

 Score = 23.0 bits (47), Expect = 4.3
 Identities = 11/51 (21%), Positives = 23/51 (45%)
 Frame = +3

Query: 72  TRKFMTDRLLARRQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFG 224
           T+ F+   LLA      D     + +  + + RE++ +MY    + + + G
Sbjct: 132 TKDFINGELLAHLYATGDQASMMEESADEAQKREEMLRMYHACKEALRIIG 182


>Y13592-1|CAA73920.1|  136|Anopheles gambiae voltage-gated sodium
          channel protein.
          Length = 136

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -3

Query: 57 FLHSFLIIFEI 25
          F+HSF+I+F +
Sbjct: 61 FMHSFMIVFRV 71


>DQ263748-1|ABB84470.1|   78|Anopheles gambiae para-type sodium
          channel variant 1 protein.
          Length = 78

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -3

Query: 57 FLHSFLIIFEI 25
          F+HSF+I+F +
Sbjct: 15 FMHSFMIVFRV 25


>DQ022109-1|AAY51997.1|   66|Anopheles gambiae voltage-gated
          sodium channel protein.
          Length = 66

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -3

Query: 57 FLHSFLIIFEI 25
          F+HSF+I+F +
Sbjct: 9  FMHSFMIVFRV 19


>DQ022108-1|AAY51996.1|   66|Anopheles gambiae voltage-gated
          sodium channel protein.
          Length = 66

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -3

Query: 57 FLHSFLIIFEI 25
          F+HSF+I+F +
Sbjct: 9  FMHSFMIVFRV 19


>AY615653-1|AAU05110.1|   71|Anopheles gambiae sodium channel
          protein.
          Length = 71

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -3

Query: 57 FLHSFLIIFEI 25
          F+HSF+I+F +
Sbjct: 18 FMHSFMIVFRV 28


>AY615652-1|AAU05109.1|   71|Anopheles gambiae sodium channel
          protein.
          Length = 71

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -3

Query: 57 FLHSFLIIFEI 25
          F+HSF+I+F +
Sbjct: 18 FMHSFMIVFRV 28


>AY615651-1|AAU05108.1|   71|Anopheles gambiae sodium channel
          protein.
          Length = 71

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -3

Query: 57 FLHSFLIIFEI 25
          F+HSF+I+F +
Sbjct: 18 FMHSFMIVFRV 28


>AY615650-1|AAU05107.1|   62|Anopheles gambiae sodium channel
          protein.
          Length = 62

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -3

Query: 57 FLHSFLIIFEI 25
          F+HSF+I+F +
Sbjct: 18 FMHSFMIVFRV 28


>AY615649-1|AAU05106.1|   71|Anopheles gambiae sodium channel
          protein.
          Length = 71

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -3

Query: 57 FLHSFLIIFEI 25
          F+HSF+I+F +
Sbjct: 18 FMHSFMIVFRV 28


>AY615648-1|AAU05105.1|   71|Anopheles gambiae sodium channel
          protein.
          Length = 71

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -3

Query: 57 FLHSFLIIFEI 25
          F+HSF+I+F +
Sbjct: 18 FMHSFMIVFRV 28


>AY615647-1|AAU05104.1|   71|Anopheles gambiae sodium channel
          protein.
          Length = 71

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -3

Query: 57 FLHSFLIIFEI 25
          F+HSF+I+F +
Sbjct: 18 FMHSFMIVFRV 28


>AY615646-1|AAU05103.1|   71|Anopheles gambiae sodium channel
          protein.
          Length = 71

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -3

Query: 57 FLHSFLIIFEI 25
          F+HSF+I+F +
Sbjct: 18 FMHSFMIVFRV 28


>AY615628-1|AAU05085.1|   71|Anopheles gambiae sodium channel
          protein.
          Length = 71

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -3

Query: 57 FLHSFLIIFEI 25
          F+HSF+I+F +
Sbjct: 18 FMHSFMIVFRV 28


>AY615618-1|AAU05075.1|   71|Anopheles gambiae sodium channel
          protein.
          Length = 71

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -3

Query: 57 FLHSFLIIFEI 25
          F+HSF+I+F +
Sbjct: 18 FMHSFMIVFRV 28


>AY615617-1|AAU05074.1|   71|Anopheles gambiae sodium channel
          protein.
          Length = 71

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -3

Query: 57 FLHSFLIIFEI 25
          F+HSF+I+F +
Sbjct: 18 FMHSFMIVFRV 28


>AY615616-1|AAU05073.1|   71|Anopheles gambiae sodium channel
          protein.
          Length = 71

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -3

Query: 57 FLHSFLIIFEI 25
          F+HSF+I+F +
Sbjct: 18 FMHSFMIVFRV 28


>AY615615-1|AAU05072.1|   69|Anopheles gambiae sodium channel
          protein.
          Length = 69

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -3

Query: 57 FLHSFLIIFEI 25
          F+HSF+I+F +
Sbjct: 18 FMHSFMIVFRV 28


>AY615614-1|AAU05071.1|   71|Anopheles gambiae sodium channel
          protein.
          Length = 71

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -3

Query: 57 FLHSFLIIFEI 25
          F+HSF+I+F +
Sbjct: 18 FMHSFMIVFRV 28


>AY615612-1|AAU05069.1|   69|Anopheles gambiae sodium channel
          protein.
          Length = 69

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -3

Query: 57 FLHSFLIIFEI 25
          F+HSF+I+F +
Sbjct: 18 FMHSFMIVFRV 28


>AY615610-1|AAU05067.1|   71|Anopheles gambiae sodium channel
          protein.
          Length = 71

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -3

Query: 57 FLHSFLIIFEI 25
          F+HSF+I+F +
Sbjct: 18 FMHSFMIVFRV 28


>AY615609-1|AAU05066.1|   71|Anopheles gambiae sodium channel
          protein.
          Length = 71

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -3

Query: 57 FLHSFLIIFEI 25
          F+HSF+I+F +
Sbjct: 18 FMHSFMIVFRV 28


>AY615608-1|AAU05065.1|   71|Anopheles gambiae sodium channel
          protein.
          Length = 71

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -3

Query: 57 FLHSFLIIFEI 25
          F+HSF+I+F +
Sbjct: 18 FMHSFMIVFRV 28


>AY615571-1|AAU05028.1|   62|Anopheles gambiae sodium channel
          protein.
          Length = 62

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -3

Query: 57 FLHSFLIIFEI 25
          F+HSF+I+F +
Sbjct: 18 FMHSFMIVFRV 28


>AY615570-1|AAU05027.1|   71|Anopheles gambiae sodium channel
          protein.
          Length = 71

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -3

Query: 57 FLHSFLIIFEI 25
          F+HSF+I+F +
Sbjct: 18 FMHSFMIVFRV 28


>AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium
            channel alpha subunitprotein.
          Length = 2139

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -3

Query: 57   FLHSFLIIFEI 25
            F+HSF+I+F +
Sbjct: 976  FMHSFMIVFRV 986


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 386,668
Number of Sequences: 2352
Number of extensions: 7304
Number of successful extensions: 35
Number of sequences better than 10.0: 27
Number of HSP's better than 10.0 without gapping: 35
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 35
length of database: 563,979
effective HSP length: 58
effective length of database: 427,563
effective search space used: 32922351
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -