Samia BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0004_P05
         (465 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF592538-1|ABQ95984.1|  582|Tribolium castaneum beta-N-acetylglu...    21   5.6  
AY316682-1|AAQ83696.1|  456|Tribolium castaneum Sp-like zinc fin...    21   5.6  
DQ855494-1|ABH88181.1|   99|Tribolium castaneum chemosensory pro...    21   7.4  
AY887136-1|AAW78361.1|  580|Tribolium castaneum vasa RNA helicas...    21   7.4  
AM292348-1|CAL23160.2|  346|Tribolium castaneum gustatory recept...    20   9.8  

>EF592538-1|ABQ95984.1|  582|Tribolium castaneum
           beta-N-acetylglucosaminidase NAG3 protein.
          Length = 582

 Score = 21.0 bits (42), Expect = 5.6
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +1

Query: 157 IWLLWCSE 180
           IW LWCS+
Sbjct: 570 IWPLWCSQ 577


>AY316682-1|AAQ83696.1|  456|Tribolium castaneum Sp-like zinc finger
           protein protein.
          Length = 456

 Score = 21.0 bits (42), Expect = 5.6
 Identities = 6/15 (40%), Positives = 7/15 (46%)
 Frame = -2

Query: 173 HHKSQIYFLHPRNFW 129
           HH   +Y  HP   W
Sbjct: 151 HHLGSVYSRHPYESW 165


>DQ855494-1|ABH88181.1|   99|Tribolium castaneum chemosensory
           protein 8 protein.
          Length = 99

 Score = 20.6 bits (41), Expect = 7.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 248 GLVKQVQGELG 280
           G+V QVQG+LG
Sbjct: 15  GVVYQVQGQLG 25


>AY887136-1|AAW78361.1|  580|Tribolium castaneum vasa RNA helicase
           protein.
          Length = 580

 Score = 20.6 bits (41), Expect = 7.4
 Identities = 6/13 (46%), Positives = 10/13 (76%)
 Frame = -2

Query: 410 SHQKKRLLGNCDL 372
           +HQ+ R+LG C +
Sbjct: 276 NHQRGRILGGCHI 288


>AM292348-1|CAL23160.2|  346|Tribolium castaneum gustatory receptor
           candidate 27 protein.
          Length = 346

 Score = 20.2 bits (40), Expect = 9.8
 Identities = 10/36 (27%), Positives = 16/36 (44%)
 Frame = -2

Query: 212 ARVQNSLPYFPSEHHKSQIYFLHPRNFWNIGNLLFL 105
           + +  +  Y P+       Y +  +NF NI NL  L
Sbjct: 59  SEISENFYYLPAMSTGPLKYAIFQKNFTNIVNLTHL 94


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 99,734
Number of Sequences: 336
Number of extensions: 1858
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 52
effective length of database: 105,113
effective search space used: 10721526
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)