Samia BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0004_M24
         (138 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667193-1|ABG75745.1|  510|Apis mellifera cys-loop ligand-gated...    20   2.4  
DQ026039-1|AAY87898.1|  427|Apis mellifera nicotinic acetylcholi...    20   2.4  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              20   3.1  
AY375535-1|AAQ82648.1|  147|Apis mellifera doublesex protein.          19   4.1  
AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    19   7.2  
AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.              19   7.2  
AY540846-1|AAS48080.1|  541|Apis mellifera neuronal nicotinic ac...    18   9.5  

>DQ667193-1|ABG75745.1|  510|Apis mellifera cys-loop ligand-gated
           ion channel subunit protein.
          Length = 510

 Score = 20.2 bits (40), Expect = 2.4
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +1

Query: 40  VVFQEHHKWED 72
           V +QE  KW+D
Sbjct: 492 VTYQEEFKWQD 502


>DQ026039-1|AAY87898.1|  427|Apis mellifera nicotinic acetylcholine
           receptor beta2subunit protein.
          Length = 427

 Score = 20.2 bits (40), Expect = 2.4
 Identities = 5/12 (41%), Positives = 8/12 (66%)
 Frame = -3

Query: 94  VCVEYVKYLPIC 59
           +CV +  Y P+C
Sbjct: 148 LCVPFTTYTPVC 159


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 19.8 bits (39), Expect = 3.1
 Identities = 7/9 (77%), Positives = 9/9 (100%)
 Frame = -1

Query: 135 VPNFVADFL 109
           VP+FVADF+
Sbjct: 126 VPSFVADFV 134


>AY375535-1|AAQ82648.1|  147|Apis mellifera doublesex protein.
          Length = 147

 Score = 19.4 bits (38), Expect = 4.1
 Identities = 10/32 (31%), Positives = 16/32 (50%)
 Frame = +1

Query: 22  SIRPTRVVFQEHHKWEDISHTPRIQNTVNQEI 117
           +I PTR +   H     ++H P+   + N EI
Sbjct: 94  TIPPTRKLPPLHPHTAMVTHLPQTLTSENVEI 125


>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
           protein.
          Length = 1370

 Score = 18.6 bits (36), Expect = 7.2
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -1

Query: 48  EDNSRGSDGEE 16
           +D S G+DG+E
Sbjct: 197 DDGSDGNDGDE 207


>AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.
          Length = 898

 Score = 18.6 bits (36), Expect = 7.2
 Identities = 6/11 (54%), Positives = 7/11 (63%)
 Frame = -3

Query: 64  ICGVLGRQLSW 32
           +CGV G   SW
Sbjct: 541 VCGVKGIPCSW 551


>AY540846-1|AAS48080.1|  541|Apis mellifera neuronal nicotinic
           acetylcholine receptorApisa2 subunit protein.
          Length = 541

 Score = 18.2 bits (35), Expect = 9.5
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = +1

Query: 103 VNQEIGDKI 129
           +NQ +GDK+
Sbjct: 178 INQNMGDKV 186


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 44,844
Number of Sequences: 438
Number of extensions: 619
Number of successful extensions: 7
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 26
effective length of database: 134,955
effective search space used:  2564145
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 35 (18.9 bits)