Samia BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0004_J14
         (565 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8JKL7 Cluster: Orf96; n=1; Heliothis zea virus 1|Rep: ...    35   1.1  

>UniRef50_Q8JKL7 Cluster: Orf96; n=1; Heliothis zea virus 1|Rep:
           Orf96 - Heliothis zea virus 1
          Length = 490

 Score = 35.1 bits (77), Expect = 1.1
 Identities = 20/69 (28%), Positives = 40/69 (57%), Gaps = 4/69 (5%)
 Frame = -3

Query: 248 LLLSC---QTKILIDFVR*KEPMNCFYLYSLFFAAYINLVNFITRKHSF-VLVLVHVGLR 81
           LLLSC   + K L+DF+   +PMN  Y+++  +++++N +N    + +F   +  ++  R
Sbjct: 301 LLLSCKREEVKGLLDFLHDTKPMNSLYMHTQIWSSFMNGLNITKNEKTFKEYMKAYMHRR 360

Query: 80  ARSRNIKHT 54
           +  +NI  T
Sbjct: 361 SLVKNIYQT 369


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 461,878,472
Number of Sequences: 1657284
Number of extensions: 7572091
Number of successful extensions: 14146
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 13881
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14146
length of database: 575,637,011
effective HSP length: 96
effective length of database: 416,537,747
effective search space used: 37904934977
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)