BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= I09A02NGRL0004_H21
(458 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AK126160-1|BAC86466.1| 203|Homo sapiens protein ( Homo sapiens ... 31 1.4
>AK126160-1|BAC86466.1| 203|Homo sapiens protein ( Homo sapiens
cDNA FLJ44172 fis, clone THYMU2036085. ).
Length = 203
Score = 31.5 bits (68), Expect = 1.4
Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 2/46 (4%)
Frame = -1
Query: 455 FFLFFTIKLKVYYYLCTKTYNSIY--ILKLIFYKSQLKYC*FKSTL 324
F + F +++YLC Y S+Y +L+ +F L+ C F S+L
Sbjct: 85 FLISFCFSEYLHFYLCVSVYFSVYLSVLQSVFLFLALRQCLFLSSL 130
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 62,918,729
Number of Sequences: 237096
Number of extensions: 1323653
Number of successful extensions: 2281
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2178
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2279
length of database: 76,859,062
effective HSP length: 84
effective length of database: 56,942,998
effective search space used: 3872123864
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -