SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0004_G08
         (470 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like recept...    22   2.9  
AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter...    21   6.7  
AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter...    21   6.7  
AF069739-1|AAC63272.2|  690|Apis mellifera translation initiatio...    21   6.7  
AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso...    21   8.8  

>DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like receptor
           2 protein.
          Length = 581

 Score = 22.2 bits (45), Expect = 2.9
 Identities = 6/30 (20%), Positives = 18/30 (60%)
 Frame = +1

Query: 157 LAWSYLKLAVGVAAMFYFIIILKEAVSLYV 246
           + W+ ++ A  ++ M +F++ +   + LY+
Sbjct: 213 MKWTLIEHAFEISTMLFFVLPMTIIIVLYI 242


>AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 593

 Score = 21.0 bits (42), Expect = 6.7
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +2

Query: 62  FIFNVIKHIPV 94
           F FN+IK +PV
Sbjct: 507 FTFNIIKFVPV 517


>AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 646

 Score = 21.0 bits (42), Expect = 6.7
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +2

Query: 62  FIFNVIKHIPV 94
           F FN+IK +PV
Sbjct: 560 FTFNIIKFVPV 570


>AF069739-1|AAC63272.2|  690|Apis mellifera translation initiation
           factor 2 protein.
          Length = 690

 Score = 21.0 bits (42), Expect = 6.7
 Identities = 6/27 (22%), Positives = 16/27 (59%)
 Frame = +2

Query: 8   YVN*NTNYHQ*NLRISIDFIFNVIKHI 88
           ++N N  Y +  +  ++  + NV+K++
Sbjct: 84  FINKNDKYEENTILTTMPLLINVVKYL 110


>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
           protein.
          Length = 1770

 Score = 20.6 bits (41), Expect = 8.8
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 152 PYLKGKQKQHLF 117
           PYL+GKQ+  +F
Sbjct: 651 PYLEGKQQMTVF 662


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 100,140
Number of Sequences: 438
Number of extensions: 1789
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 12682287
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -