Samia BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0004_F17
         (638 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ000675-1|CAA04232.1|  600|Anopheles gambiae infection responsi...    25   2.0  
AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro...    24   4.7  
AF515471-1|AAM61879.1|  225|Anopheles gambiae glutathione S-tran...    23   8.2  
AF491816-1|AAM09542.2|  225|Anopheles gambiae glutathione S-tran...    23   8.2  

>AJ000675-1|CAA04232.1|  600|Anopheles gambiae infection responsive
           serine proteaselike protein protein.
          Length = 600

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 1/44 (2%)
 Frame = +1

Query: 496 SGVHEINILDEE-GWASLRRARRSDPTATVAPLLAIQLHHPGSY 624
           S  HE+ I  E+ G  S+ +  R  P+A +  +  ++L HP  Y
Sbjct: 399 SSTHEMAIPREDIGVKSVHQHPRYSPSALLNNIAVLELAHPVQY 442


>AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein.
          Length = 2051

 Score = 23.8 bits (49), Expect = 4.7
 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 2/39 (5%)
 Frame = +2

Query: 281  QNPKVEATSF--TSLDATVVTQIAYITEFH*NATIHCLR 391
            + P+  A S+  T ++ +   Q AY TE+H  A  HC++
Sbjct: 1855 RKPEYFAASYALTGMNCSGPAQ-AYFTEYHQKAQQHCVK 1892


>AF515471-1|AAM61879.1|  225|Anopheles gambiae glutathione
           S-transferase 3-8 protein.
          Length = 225

 Score = 23.0 bits (47), Expect = 8.2
 Identities = 8/12 (66%), Positives = 11/12 (91%)
 Frame = +2

Query: 500 EFMKSTSWMRRV 535
           +F KST+WMRR+
Sbjct: 181 KFPKSTAWMRRM 192


>AF491816-1|AAM09542.2|  225|Anopheles gambiae glutathione
           S-transferase E7 protein.
          Length = 225

 Score = 23.0 bits (47), Expect = 8.2
 Identities = 8/12 (66%), Positives = 11/12 (91%)
 Frame = +2

Query: 500 EFMKSTSWMRRV 535
           +F KST+WMRR+
Sbjct: 181 KFPKSTAWMRRM 192


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 582,282
Number of Sequences: 2352
Number of extensions: 12407
Number of successful extensions: 15
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 15
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 62723250
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)