Samia BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0004_D07
         (477 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_04_0881 + 29055724-29059197                                         28   4.5  
05_01_0468 + 3715777-3715810,3716485-3716528,3716572-3716960,371...    27   7.8  

>04_04_0881 + 29055724-29059197
          Length = 1157

 Score = 27.9 bits (59), Expect = 4.5
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = +3

Query: 198 CLCCIYSALRW 230
           C CC+YS LRW
Sbjct: 783 CCCCVYSLLRW 793


>05_01_0468 +
           3715777-3715810,3716485-3716528,3716572-3716960,
           3717081-3717330,3717614-3717619
          Length = 240

 Score = 27.1 bits (57), Expect = 7.8
 Identities = 14/37 (37%), Positives = 24/37 (64%), Gaps = 1/37 (2%)
 Frame = -3

Query: 139 NFYCDINDLISHINTWFYINKIFV-CDKINTYFLLII 32
           NFY  +    +H+  +FY  +I V CDK+N++F ++I
Sbjct: 73  NFYYILT--CAHLFEYFYSAEIKVDCDKLNSWFNILI 107


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,856,154
Number of Sequences: 37544
Number of extensions: 164015
Number of successful extensions: 277
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 273
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 277
length of database: 14,793,348
effective HSP length: 76
effective length of database: 11,940,004
effective search space used: 979080328
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)