SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0004_C05
         (320 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY569717-1|AAS86670.1|  397|Apis mellifera complementary sex det...    21   3.7  
AY569712-1|AAS86665.1|  408|Apis mellifera complementary sex det...    21   3.7  
DQ325102-1|ABD14116.1|  183|Apis mellifera complementary sex det...    20   8.4  
DQ325101-1|ABD14115.1|  182|Apis mellifera complementary sex det...    20   8.4  
DQ325100-1|ABD14114.1|  183|Apis mellifera complementary sex det...    20   8.4  
DQ325099-1|ABD14113.1|  183|Apis mellifera complementary sex det...    20   8.4  
DQ325098-1|ABD14112.1|  183|Apis mellifera complementary sex det...    20   8.4  
DQ325097-1|ABD14111.1|  183|Apis mellifera complementary sex det...    20   8.4  
DQ325096-1|ABD14110.1|  183|Apis mellifera complementary sex det...    20   8.4  
DQ325095-1|ABD14109.1|  183|Apis mellifera complementary sex det...    20   8.4  
DQ325077-1|ABD14091.1|  181|Apis mellifera complementary sex det...    20   8.4  
DQ325076-1|ABD14090.1|  191|Apis mellifera complementary sex det...    20   8.4  
AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex det...    20   8.4  

>AY569717-1|AAS86670.1|  397|Apis mellifera complementary sex
           determiner protein.
          Length = 397

 Score = 21.0 bits (42), Expect = 3.7
 Identities = 9/33 (27%), Positives = 17/33 (51%)
 Frame = -2

Query: 127 KPEPERTRRKISLRSSSLNIVNFNKRNIELKIY 29
           + E ER++    + S++ N  N+N      K+Y
Sbjct: 292 RTERERSKETKIISSNNYNYKNYNNNYNSKKLY 324


>AY569712-1|AAS86665.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 21.0 bits (42), Expect = 3.7
 Identities = 9/33 (27%), Positives = 17/33 (51%)
 Frame = -2

Query: 127 KPEPERTRRKISLRSSSLNIVNFNKRNIELKIY 29
           + E ER++    + S++ N  N+N      K+Y
Sbjct: 303 RTERERSKETKIISSNNYNYKNYNNNYNSKKLY 335


>DQ325102-1|ABD14116.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 19.8 bits (39), Expect = 8.4
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -2

Query: 319 YNNHKKVY 296
           YNN+KK+Y
Sbjct: 103 YNNYKKLY 110


>DQ325101-1|ABD14115.1|  182|Apis mellifera complementary sex
           determiner protein.
          Length = 182

 Score = 19.8 bits (39), Expect = 8.4
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -2

Query: 319 YNNHKKVY 296
           YNN+KK+Y
Sbjct: 103 YNNYKKLY 110


>DQ325100-1|ABD14114.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 19.8 bits (39), Expect = 8.4
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -2

Query: 319 YNNHKKVY 296
           YNN+KK+Y
Sbjct: 103 YNNYKKLY 110


>DQ325099-1|ABD14113.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 19.8 bits (39), Expect = 8.4
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -2

Query: 319 YNNHKKVY 296
           YNN+KK+Y
Sbjct: 103 YNNYKKLY 110


>DQ325098-1|ABD14112.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 19.8 bits (39), Expect = 8.4
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -2

Query: 319 YNNHKKVY 296
           YNN+KK+Y
Sbjct: 103 YNNYKKLY 110


>DQ325097-1|ABD14111.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 19.8 bits (39), Expect = 8.4
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -2

Query: 319 YNNHKKVY 296
           YNN+KK+Y
Sbjct: 103 YNNYKKLY 110


>DQ325096-1|ABD14110.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 19.8 bits (39), Expect = 8.4
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -2

Query: 319 YNNHKKVY 296
           YNN+KK+Y
Sbjct: 103 YNNYKKLY 110


>DQ325095-1|ABD14109.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 19.8 bits (39), Expect = 8.4
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -2

Query: 319 YNNHKKVY 296
           YNN+KK+Y
Sbjct: 103 YNNYKKLY 110


>DQ325077-1|ABD14091.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 19.8 bits (39), Expect = 8.4
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -2

Query: 319 YNNHKKVY 296
           YNN+KK+Y
Sbjct: 101 YNNYKKLY 108


>DQ325076-1|ABD14090.1|  191|Apis mellifera complementary sex
           determiner protein.
          Length = 191

 Score = 19.8 bits (39), Expect = 8.4
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -2

Query: 319 YNNHKKVY 296
           YNN+KK+Y
Sbjct: 111 YNNYKKLY 118


>AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex
           determiner protein.
          Length = 426

 Score = 19.8 bits (39), Expect = 8.4
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -2

Query: 319 YNNHKKVY 296
           YNN+KK+Y
Sbjct: 346 YNNYKKLY 353


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 73,931
Number of Sequences: 438
Number of extensions: 1277
Number of successful extensions: 13
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 146,343
effective HSP length: 50
effective length of database: 124,443
effective search space used:  6968808
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)

- SilkBase 1999-2023 -