Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= I09A02NGRL0004_C05
(320 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 3.7
AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 21 3.7
DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 20 8.4
DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 20 8.4
DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 20 8.4
DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 20 8.4
DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 20 8.4
DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 20 8.4
DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 20 8.4
DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 20 8.4
DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 20 8.4
DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 20 8.4
AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 20 8.4
>AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex
determiner protein.
Length = 397
Score = 21.0 bits (42), Expect = 3.7
Identities = 9/33 (27%), Positives = 17/33 (51%)
Frame = -2
Query: 127 KPEPERTRRKISLRSSSLNIVNFNKRNIELKIY 29
+ E ER++ + S++ N N+N K+Y
Sbjct: 292 RTERERSKETKIISSNNYNYKNYNNNYNSKKLY 324
>AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex
determiner protein.
Length = 408
Score = 21.0 bits (42), Expect = 3.7
Identities = 9/33 (27%), Positives = 17/33 (51%)
Frame = -2
Query: 127 KPEPERTRRKISLRSSSLNIVNFNKRNIELKIY 29
+ E ER++ + S++ N N+N K+Y
Sbjct: 303 RTERERSKETKIISSNNYNYKNYNNNYNSKKLY 335
>DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex
determiner protein.
Length = 183
Score = 19.8 bits (39), Expect = 8.4
Identities = 6/8 (75%), Positives = 8/8 (100%)
Frame = -2
Query: 319 YNNHKKVY 296
YNN+KK+Y
Sbjct: 103 YNNYKKLY 110
>DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex
determiner protein.
Length = 182
Score = 19.8 bits (39), Expect = 8.4
Identities = 6/8 (75%), Positives = 8/8 (100%)
Frame = -2
Query: 319 YNNHKKVY 296
YNN+KK+Y
Sbjct: 103 YNNYKKLY 110
>DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex
determiner protein.
Length = 183
Score = 19.8 bits (39), Expect = 8.4
Identities = 6/8 (75%), Positives = 8/8 (100%)
Frame = -2
Query: 319 YNNHKKVY 296
YNN+KK+Y
Sbjct: 103 YNNYKKLY 110
>DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex
determiner protein.
Length = 183
Score = 19.8 bits (39), Expect = 8.4
Identities = 6/8 (75%), Positives = 8/8 (100%)
Frame = -2
Query: 319 YNNHKKVY 296
YNN+KK+Y
Sbjct: 103 YNNYKKLY 110
>DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex
determiner protein.
Length = 183
Score = 19.8 bits (39), Expect = 8.4
Identities = 6/8 (75%), Positives = 8/8 (100%)
Frame = -2
Query: 319 YNNHKKVY 296
YNN+KK+Y
Sbjct: 103 YNNYKKLY 110
>DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex
determiner protein.
Length = 183
Score = 19.8 bits (39), Expect = 8.4
Identities = 6/8 (75%), Positives = 8/8 (100%)
Frame = -2
Query: 319 YNNHKKVY 296
YNN+KK+Y
Sbjct: 103 YNNYKKLY 110
>DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex
determiner protein.
Length = 183
Score = 19.8 bits (39), Expect = 8.4
Identities = 6/8 (75%), Positives = 8/8 (100%)
Frame = -2
Query: 319 YNNHKKVY 296
YNN+KK+Y
Sbjct: 103 YNNYKKLY 110
>DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex
determiner protein.
Length = 183
Score = 19.8 bits (39), Expect = 8.4
Identities = 6/8 (75%), Positives = 8/8 (100%)
Frame = -2
Query: 319 YNNHKKVY 296
YNN+KK+Y
Sbjct: 103 YNNYKKLY 110
>DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 19.8 bits (39), Expect = 8.4
Identities = 6/8 (75%), Positives = 8/8 (100%)
Frame = -2
Query: 319 YNNHKKVY 296
YNN+KK+Y
Sbjct: 101 YNNYKKLY 108
>DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex
determiner protein.
Length = 191
Score = 19.8 bits (39), Expect = 8.4
Identities = 6/8 (75%), Positives = 8/8 (100%)
Frame = -2
Query: 319 YNNHKKVY 296
YNN+KK+Y
Sbjct: 111 YNNYKKLY 118
>AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex
determiner protein.
Length = 426
Score = 19.8 bits (39), Expect = 8.4
Identities = 6/8 (75%), Positives = 8/8 (100%)
Frame = -2
Query: 319 YNNHKKVY 296
YNN+KK+Y
Sbjct: 346 YNNYKKLY 353
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 73,931
Number of Sequences: 438
Number of extensions: 1277
Number of successful extensions: 13
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 146,343
effective HSP length: 50
effective length of database: 124,443
effective search space used: 6968808
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)
- SilkBase 1999-2023 -