Samia BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0004_B23
         (437 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY569781-1|AAS75781.1|  461|Apis mellifera neuronal nicotinic ac...    23   1.1  
AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.          21   5.9  
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    21   7.9  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    21   7.9  

>AY569781-1|AAS75781.1|  461|Apis mellifera neuronal nicotinic
           acetylcholine Apisa7-2 subunit protein.
          Length = 461

 Score = 23.4 bits (48), Expect = 1.1
 Identities = 14/39 (35%), Positives = 18/39 (46%)
 Frame = -2

Query: 436 IPSSIVSGQSLFTEATFSVVVFICTSRVRLAPRYFIPLI 320
           +PS      +L   A  S+ VF+ T R  L P    PLI
Sbjct: 237 VPSESGEKVTLGISALLSMTVFLMTIRESLPPTEKTPLI 275


>AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.
          Length = 652

 Score = 21.0 bits (42), Expect = 5.9
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +3

Query: 33  KDGPAMTWSMHSI 71
           KDGP  +WS  S+
Sbjct: 458 KDGPTKSWSDESL 470


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
            AbsCAM-Ig7B protein.
          Length = 1923

 Score = 20.6 bits (41), Expect = 7.9
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = +2

Query: 125  LPKLRQGTIQG 157
            LP+LR G IQG
Sbjct: 1031 LPELRHGDIQG 1041


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
            AbsCAM-Ig7A protein.
          Length = 1919

 Score = 20.6 bits (41), Expect = 7.9
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = +2

Query: 125  LPKLRQGTIQG 157
            LP+LR G IQG
Sbjct: 1027 LPELRHGDIQG 1037


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 124,791
Number of Sequences: 438
Number of extensions: 2508
Number of successful extensions: 5
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 11327868
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)