BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= I09A02NGRL0004_B10
(394 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 22 7.0
DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domai... 22 9.2
>EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium
channel alpha1 subunit protein.
Length = 1893
Score = 22.2 bits (45), Expect = 7.0
Identities = 15/64 (23%), Positives = 30/64 (46%)
Frame = +2
Query: 170 VDVKSVIESAAALLLFKKYCNNRVLCIVLKVIMFNILSIGLFVTIIMNVKAYPSIFSGES 349
+DV +++ + L F K C +RV C L + + S G T++ N + + +
Sbjct: 1464 LDVVTLLRKISPPLGFGKLCPHRVACKRLVSMNMPLNSDG---TVLFNATLFAVVRTSLK 1520
Query: 350 VENE 361
++ E
Sbjct: 1521 IKTE 1524
>DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domain
polypeptide protein.
Length = 194
Score = 21.8 bits (44), Expect = 9.2
Identities = 7/13 (53%), Positives = 10/13 (76%)
Frame = +1
Query: 280 VYWIVCDNYYERE 318
VY + CD+ YER+
Sbjct: 152 VYQLACDSRYERD 164
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 393,555
Number of Sequences: 2352
Number of extensions: 6812
Number of successful extensions: 9
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 563,979
effective HSP length: 58
effective length of database: 427,563
effective search space used: 30784536
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -