SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0003_L08
         (519 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC359.05 |abc3||ABC transporter Abc3|Schizosaccharomyces pombe...    27   1.7  

>SPBC359.05 |abc3||ABC transporter Abc3|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 1465

 Score = 27.1 bits (57), Expect = 1.7
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 3/46 (6%)
 Frame = +3

Query: 60  LVTSHRLMYVH*KIRYNFCTAATYLYVLFVTFV---TSHVPLQVLL 188
           ++T   + Y    I +NF +  TY +VLF+ F    T  VP+  LL
Sbjct: 57  IITQIYVGYKTKNIGWNFFSVVTYCFVLFLQFAEQSTLRVPMASLL 102


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,949,308
Number of Sequences: 5004
Number of extensions: 35610
Number of successful extensions: 58
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 56
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 58
length of database: 2,362,478
effective HSP length: 68
effective length of database: 2,022,206
effective search space used: 210309424
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -