SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0003_J24
         (571 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

10_05_0038 - 8458901-8459207,8459367-8459705,8459710-8459913,846...    28   4.6  

>10_05_0038 -
           8458901-8459207,8459367-8459705,8459710-8459913,
           8460374-8460492
          Length = 322

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 1/38 (2%)
 Frame = +2

Query: 32  IYSNITVKRRYGA-LTAFSCDISFSCGKT*TVPRKRRF 142
           +Y   T +RR GA L+  +C++S  C     +PR+ R+
Sbjct: 134 VYQEKTRRRRRGAKLSTATCEVSLPCATMVRMPRRLRW 171


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,888,610
Number of Sequences: 37544
Number of extensions: 248498
Number of successful extensions: 546
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 536
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 546
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1317005676
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -