Samia BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0003_I17
         (321 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY341201-1|AAR13765.1|  154|Anopheles gambiae NOS protein.             22   4.9  
AY341200-1|AAR13764.1|  154|Anopheles gambiae NOS protein.             22   4.9  
AY341199-1|AAR13763.1|  154|Anopheles gambiae NOS protein.             22   4.9  
AY341198-1|AAR13762.1|  154|Anopheles gambiae NOS protein.             22   4.9  
AY341197-1|AAR13761.1|  154|Anopheles gambiae NOS protein.             22   4.9  
AY341196-1|AAR13760.1|  154|Anopheles gambiae NOS protein.             22   4.9  
AJ821850-1|CAH25390.1|  426|Anopheles gambiae alpha-2,6-sialyltr...    22   6.5  
AY705398-1|AAU12507.1|  555|Anopheles gambiae nicotinic acetylch...    21   8.6  
AY705397-1|AAU12506.1|  555|Anopheles gambiae nicotinic acetylch...    21   8.6  
AF080564-1|AAC31944.1|  372|Anopheles gambiae Sex combs reduced ...    21   8.6  
AF007166-1|AAB62929.1|  360|Anopheles gambiae serine protease 14...    21   8.6  

>AY341201-1|AAR13765.1|  154|Anopheles gambiae NOS protein.
          Length = 154

 Score = 22.2 bits (45), Expect = 4.9
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +2

Query: 131 VYQAWRLWEFP 163
           VY+ WR W+ P
Sbjct: 94  VYEDWRYWKLP 104


>AY341200-1|AAR13764.1|  154|Anopheles gambiae NOS protein.
          Length = 154

 Score = 22.2 bits (45), Expect = 4.9
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +2

Query: 131 VYQAWRLWEFP 163
           VY+ WR W+ P
Sbjct: 94  VYEDWRYWKLP 104


>AY341199-1|AAR13763.1|  154|Anopheles gambiae NOS protein.
          Length = 154

 Score = 22.2 bits (45), Expect = 4.9
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +2

Query: 131 VYQAWRLWEFP 163
           VY+ WR W+ P
Sbjct: 94  VYEDWRYWKLP 104


>AY341198-1|AAR13762.1|  154|Anopheles gambiae NOS protein.
          Length = 154

 Score = 22.2 bits (45), Expect = 4.9
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +2

Query: 131 VYQAWRLWEFP 163
           VY+ WR W+ P
Sbjct: 94  VYEDWRYWKLP 104


>AY341197-1|AAR13761.1|  154|Anopheles gambiae NOS protein.
          Length = 154

 Score = 22.2 bits (45), Expect = 4.9
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +2

Query: 131 VYQAWRLWEFP 163
           VY+ WR W+ P
Sbjct: 94  VYEDWRYWKLP 104


>AY341196-1|AAR13760.1|  154|Anopheles gambiae NOS protein.
          Length = 154

 Score = 22.2 bits (45), Expect = 4.9
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +2

Query: 131 VYQAWRLWEFP 163
           VY+ WR W+ P
Sbjct: 94  VYEDWRYWKLP 104


>AJ821850-1|CAH25390.1|  426|Anopheles gambiae
           alpha-2,6-sialyltransferase protein.
          Length = 426

 Score = 21.8 bits (44), Expect = 6.5
 Identities = 5/11 (45%), Positives = 8/11 (72%)
 Frame = +2

Query: 152 WEFPPFVWGDL 184
           W+ PPF W ++
Sbjct: 175 WKEPPFTWNEI 185


>AY705398-1|AAU12507.1|  555|Anopheles gambiae nicotinic
           acetylcholine receptor subunitalpha 4 protein.
          Length = 555

 Score = 21.4 bits (43), Expect = 8.6
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = -1

Query: 231 IIISIHLTVNASTVGYKSPQT 169
           + ISI +TV    V ++SPQT
Sbjct: 317 VSISICVTVVVLNVHFRSPQT 337


>AY705397-1|AAU12506.1|  555|Anopheles gambiae nicotinic
           acetylcholine receptor subunitalpha 4 protein.
          Length = 555

 Score = 21.4 bits (43), Expect = 8.6
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = -1

Query: 231 IIISIHLTVNASTVGYKSPQT 169
           + ISI +TV    V ++SPQT
Sbjct: 317 VSISICVTVVVLNVHFRSPQT 337


>AF080564-1|AAC31944.1|  372|Anopheles gambiae Sex combs reduced
           homeotic protein protein.
          Length = 372

 Score = 21.4 bits (43), Expect = 8.6
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +1

Query: 16  PPFIYPWV 39
           PP IYPW+
Sbjct: 257 PPHIYPWM 264


>AF007166-1|AAB62929.1|  360|Anopheles gambiae serine protease 14D
           protein.
          Length = 360

 Score = 21.4 bits (43), Expect = 8.6
 Identities = 14/37 (37%), Positives = 16/37 (43%)
 Frame = -3

Query: 139 LVDELANMVGDFGTQRLPTVAYPLVYIP*SPFTTPTD 29
           L  +  N VG+ G   L     PLV I   P  TP D
Sbjct: 27  LGQDCVNPVGEAGKCVLFRECQPLVDIYNKPVNTPDD 63


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 366,217
Number of Sequences: 2352
Number of extensions: 8267
Number of successful extensions: 15
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 15
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15
length of database: 563,979
effective HSP length: 56
effective length of database: 432,267
effective search space used: 21613350
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)