Samia BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0003_F17
         (448 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q6BWV1 Cluster: Similar to tr|O42839 Schizosaccharomyce...    32   4.9  

>UniRef50_Q6BWV1 Cluster: Similar to tr|O42839 Schizosaccharomyces
           pombe CYCLOSOME/APC subunit CUT20/APC4; n=1;
           Debaryomyces hansenii|Rep: Similar to tr|O42839
           Schizosaccharomyces pombe CYCLOSOME/APC subunit
           CUT20/APC4 - Debaryomyces hansenii (Yeast) (Torulaspora
           hansenii)
          Length = 687

 Score = 32.3 bits (70), Expect = 4.9
 Identities = 15/41 (36%), Positives = 26/41 (63%)
 Frame = -1

Query: 139 FNKCHININISRHLSERVEQTRIVDFHFELSTVVKSNILGN 17
           FN   IN+ ++  L + V +T ++D + EL+  V+SN+L N
Sbjct: 483 FNYFEINLPMNEILLQEVVETNLMDKYIELNRFVESNLLCN 523


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 407,483,382
Number of Sequences: 1657284
Number of extensions: 7289309
Number of successful extensions: 11855
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 11630
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11855
length of database: 575,637,011
effective HSP length: 93
effective length of database: 421,509,599
effective search space used: 23183027945
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)