Samia BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0003_B05
         (401 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso...    21   5.3  
DQ485318-1|ABF21077.1|  223|Apis mellifera icarapin variant 1 pr...    20   9.2  
DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450 monoo...    20   9.2  
AY939856-1|AAX33236.1|  223|Apis mellifera venom carbohydrate-ri...    20   9.2  
AY897570-1|AAW81036.1|  223|Apis mellifera venom protein 2 protein.    20   9.2  

>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
           protein.
          Length = 1770

 Score = 21.0 bits (42), Expect = 5.3
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +2

Query: 293 SANGPVSVKSTKTARLGKSSVALA*FSRISVRRRQ 397
           S+NG + V STK   +  S  +    S  SV+ R+
Sbjct: 815 SSNGDIKVPSTKVLAMISSVKSFMELSLRSVKDRE 849


>DQ485318-1|ABF21077.1|  223|Apis mellifera icarapin variant 1
           precursor protein.
          Length = 223

 Score = 20.2 bits (40), Expect = 9.2
 Identities = 6/12 (50%), Positives = 7/12 (58%)
 Frame = +3

Query: 66  WCYGCEHSTPGS 101
           W   C HS PG+
Sbjct: 12  WFIACTHSFPGA 23


>DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 517

 Score = 20.2 bits (40), Expect = 9.2
 Identities = 7/16 (43%), Positives = 11/16 (68%)
 Frame = +1

Query: 142 LHEAAKALDKRQAVLC 189
           +H+A K L++R   LC
Sbjct: 79  IHDAYKDLNQRYGALC 94


>AY939856-1|AAX33236.1|  223|Apis mellifera venom carbohydrate-rich
           protein precursor protein.
          Length = 223

 Score = 20.2 bits (40), Expect = 9.2
 Identities = 6/12 (50%), Positives = 7/12 (58%)
 Frame = +3

Query: 66  WCYGCEHSTPGS 101
           W   C HS PG+
Sbjct: 12  WFIACTHSFPGA 23


>AY897570-1|AAW81036.1|  223|Apis mellifera venom protein 2 protein.
          Length = 223

 Score = 20.2 bits (40), Expect = 9.2
 Identities = 6/12 (50%), Positives = 7/12 (58%)
 Frame = +3

Query: 66  WCYGCEHSTPGS 101
           W   C HS PG+
Sbjct: 12  WFIACTHSFPGA 23


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 107,784
Number of Sequences: 438
Number of extensions: 2077
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 52
effective length of database: 123,567
effective search space used: 10008927
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)