Samia BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0002_P11
         (521 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF260820-1|AAG02018.1|  139|Tribolium castaneum alpha-esterase l...    23   2.2  
EF592178-1|ABQ95974.1|  532|Tribolium castaneum tyrosine hydroxy...    21   8.7  

>AF260820-1|AAG02018.1|  139|Tribolium castaneum alpha-esterase like
           protein E1 protein.
          Length = 139

 Score = 22.6 bits (46), Expect = 2.2
 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 2/38 (5%)
 Frame = +2

Query: 320 EPIKHWTGVVDFNHPNYP-PKRYEXTLSPVVGSK-CLI 427
           +P ++WTGV+D      P   R+    + +VGS+ CL+
Sbjct: 20  QPPENWTGVLDATKEGDPCYGRHFFKKNLIVGSENCLV 57


>EF592178-1|ABQ95974.1|  532|Tribolium castaneum tyrosine
           hydroxylase protein.
          Length = 532

 Score = 20.6 bits (41), Expect = 8.7
 Identities = 6/13 (46%), Positives = 8/13 (61%)
 Frame = +2

Query: 347 VDFNHPNYPPKRY 385
           +D NHP +  K Y
Sbjct: 217 LDMNHPGFADKEY 229


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 107,445
Number of Sequences: 336
Number of extensions: 1868
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 12573240
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)