Samia BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0002_O09
         (557 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q7RI96 Cluster: Putative yir1 protein; n=10; Plasmodium...    33   4.5  

>UniRef50_Q7RI96 Cluster: Putative yir1 protein; n=10; Plasmodium
           yoelii yoelii|Rep: Putative yir1 protein - Plasmodium
           yoelii yoelii
          Length = 393

 Score = 33.1 bits (72), Expect = 4.5
 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 3/65 (4%)
 Frame = +3

Query: 252 RRASRDERNAPXK-RYII*NKRKTMLFINSYIYCIIYVNEGGIIRVFIY--KLI*RRTYK 422
           +R+S D R    K +Y++ N    + F+N  IY I+++    I   F+Y  K++  +TY 
Sbjct: 289 KRSSFDFRERLQKIKYLVYNNCHYIRFVNPDIYRIMHII---IYNAFLYLMKILFSKTYL 345

Query: 423 HAICF 437
           H ICF
Sbjct: 346 HHICF 350


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 377,647,097
Number of Sequences: 1657284
Number of extensions: 5425948
Number of successful extensions: 10791
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 10499
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10755
length of database: 575,637,011
effective HSP length: 96
effective length of database: 416,537,747
effective search space used: 37071859483
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)