BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= I09A02NGRL0002_M24
(602 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 22 4.0
EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 22 5.3
>DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly
protein 9 protein.
Length = 423
Score = 22.2 bits (45), Expect = 4.0
Identities = 6/10 (60%), Positives = 9/10 (90%)
Frame = -3
Query: 495 ISYNVWWKIL 466
+S+N+WW IL
Sbjct: 1 MSFNIWWLIL 10
>EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein.
Length = 684
Score = 21.8 bits (44), Expect = 5.3
Identities = 11/31 (35%), Positives = 19/31 (61%)
Frame = +3
Query: 138 WYVHTSSKIESRTLYRSKLNFYIKYILLNTF 230
WY++ +E+ KLN++I+ I LNT+
Sbjct: 208 WYLNHDYNLEN------KLNYFIEDIGLNTY 232
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 160,712
Number of Sequences: 438
Number of extensions: 3147
Number of successful extensions: 6
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 17726685
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -