BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_M02 (531 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58517| Best HMM Match : Ribosomal_L30_N (HMM E-Value=1.5e-32) 192 1e-49 SB_55640| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_13893| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_19021| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_56940| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_37670| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_8804| Best HMM Match : RGS (HMM E-Value=1.5e-37) 28 5.4 SB_3843| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_58727| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_41944| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_29786| Best HMM Match : I-set (HMM E-Value=0) 27 9.5 SB_28087| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_24942| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 >SB_58517| Best HMM Match : Ribosomal_L30_N (HMM E-Value=1.5e-32) Length = 245 Score = 192 bits (469), Expect = 1e-49 Identities = 93/160 (58%), Positives = 117/160 (73%) Frame = +1 Query: 16 EDSKKLPAVPESVXXXXXXXXXXXXXXXQITLKRRSASIKKRKEIFKRAEQYVKEYRIKE 195 +D K+P VPE++ + L ++ KRKEIFKRAE+YVKEYR KE Sbjct: 3 QDRVKVPRVPETLLKKRKSLEQIKAARAKAQLAQKKLQHGKRKEIFKRAEKYVKEYRQKE 62 Query: 196 RDEIRLARQARNRGNYYVPGEAKLAFVIRIRGVNQVSPKVRKVLQLFRLRQINNGVFVRL 375 DE+R+ + A+ GN+YVP EA+LAFVIRIRG+N VSPKVRK+LQL RLRQINNGVFVRL Sbjct: 63 VDELRMKKMAKKHGNFYVPPEARLAFVIRIRGINGVSPKVRKILQLLRLRQINNGVFVRL 122 Query: 376 NKATVNMLRIAEPYIAWGYPNLKSVRELGVQTRFRQTERE 495 NKAT NMLRI +PYIA+GYPNLKSVREL + + + +++ Sbjct: 123 NKATANMLRIVQPYIAFGYPNLKSVRELIYKRGYGKVDKQ 162 Score = 32.7 bits (71), Expect = 0.19 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = +2 Query: 407 LSPILHGATPT*RVSESWVYKRGFAKLNGKRVPITSNSLIE 529 + P + P + +YKRG+ K++ +RV +T NS++E Sbjct: 133 VQPYIAFGYPNLKSVRELIYKRGYGKVDKQRVALTDNSIVE 173 >SB_55640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1071 Score = 29.1 bits (62), Expect = 2.4 Identities = 17/55 (30%), Positives = 24/55 (43%) Frame = -3 Query: 517 VGGDRDTLPVQFGETAFVHPTLGHSSSWGSPMQYRAQRYEACSLWPC*DERTRRC 353 V +R P Q + P +S + +P Q ++RY A S PC ER C Sbjct: 580 VNSERYHAPSQVNSERYNAPNQVNSERYNAPSQVNSERYNAPSQSPC-TERYTPC 633 >SB_13893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +1 Query: 118 RSASIKKRKEIFKRAEQYVKEYRIKERDEIRLARQARNRGNY 243 R + +R+EI++R E Y + + R+ RL R R Y Sbjct: 27 RRREMYRRREIYRRREMYRRREMYRRREMYRLREMYRRREMY 68 >SB_19021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 590 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 272 LSSVFVVSTKYHPRYARYCSCSGCVRS 352 L S+FV +T RY YC+C G + S Sbjct: 286 LGSIFVWATGNGGRYNDYCNCDGYITS 312 >SB_56940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1981 Score = 28.3 bits (60), Expect = 4.1 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 208 RLARQARNRGNYYVPGEAKLAFVIRIRGVNQVSPKVRK 321 RL R + R NYY+ + +AF + I V + P R+ Sbjct: 1886 RLRRTEKRRQNYYIATQKLMAFALNIYEVLKDDPLTRR 1923 >SB_37670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 27.9 bits (59), Expect = 5.4 Identities = 9/36 (25%), Positives = 22/36 (61%) Frame = +1 Query: 121 SASIKKRKEIFKRAEQYVKEYRIKERDEIRLARQAR 228 S +KRK +FK ++ K+ ++++ D +++ Q + Sbjct: 802 STETRKRKHVFKSGDRTAKKRKLEDNDHEKISTQVK 837 >SB_8804| Best HMM Match : RGS (HMM E-Value=1.5e-37) Length = 712 Score = 27.9 bits (59), Expect = 5.4 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 190 KERDEIRLARQARNRGNYYVP 252 K RD +AR+ R+RG YY+P Sbjct: 483 KIRDTSSIARETRSRGPYYLP 503 >SB_3843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 27.5 bits (58), Expect = 7.2 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +1 Query: 118 RSASIKKRKEIFKRAEQYVKEYRIKERDEIRLARQARNRGNY 243 R +I +R+E+++R E Y + + R+ R R R Y Sbjct: 16 RRRAINRRREMYRRREMYRRREMYRRREMYRRREMYRRREMY 57 >SB_58727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 27.1 bits (57), Expect = 9.5 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -1 Query: 237 ATVTSLSCQSDF-ITLLDAVFFDILFGSLKD 148 ATV+ S + F T L V+FD F SLKD Sbjct: 6 ATVSGRSMRLSFGATALSGVWFDFYFSSLKD 36 >SB_41944| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 698 Score = 27.1 bits (57), Expect = 9.5 Identities = 18/54 (33%), Positives = 25/54 (46%) Frame = -2 Query: 323 TLRTLGDTWLTPRIRMTNASLASPGT**LPRLRACLANLISSRSLMRYSLTYCS 162 TL +L D + PR+ + SL PG +PRL L +L + R L S Sbjct: 467 TLLSLTDPGVIPRLLLALLSLTDPGV--IPRLLLALLSLTHPEVIPRLLLALLS 518 >SB_29786| Best HMM Match : I-set (HMM E-Value=0) Length = 6300 Score = 27.1 bits (57), Expect = 9.5 Identities = 12/45 (26%), Positives = 23/45 (51%) Frame = +1 Query: 133 KKRKEIFKRAEQYVKEYRIKERDEIRLARQARNRGNYYVPGEAKL 267 KK KE+ + Q ++ + + D RLA + R R +P + ++ Sbjct: 967 KKAKELVSKQRQISTKFELMDNDLYRLAEKLRERKRLGLPEQEEV 1011 >SB_28087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1501 Score = 27.1 bits (57), Expect = 9.5 Identities = 14/53 (26%), Positives = 29/53 (54%) Frame = +1 Query: 109 LKRRSASIKKRKEIFKRAEQYVKEYRIKERDEIRLARQARNRGNYYVPGEAKL 267 ++R ++R+E +R + +E R++ DE+R R+ +RG + E +L Sbjct: 1148 MRREEKDARRREEEERRLRE--EEDRLRREDELRRKREDDDRGRRKLAEERRL 1198 >SB_24942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 27.1 bits (57), Expect = 9.5 Identities = 24/76 (31%), Positives = 34/76 (44%), Gaps = 1/76 (1%) Frame = +2 Query: 215 QDRLVTVAIIMCPVKLN*HLSSVFVVSTKYHPRYARYCSCSGCVRSTTACSFVSTRPQ*T 394 QDRL I+ P + + +F S K PR A CS + + S T + +T + Sbjct: 8 QDRLAGRRIVAQPSAI---AAFLFATSFKGEPRAAAKCSLNRLLTSWTEGTRHTTLSETF 64 Query: 395 CFVSLSPI-LHGATPT 439 F LS HGA P+ Sbjct: 65 AFARLSRFHQHGAYPS 80 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,086,645 Number of Sequences: 59808 Number of extensions: 335882 Number of successful extensions: 1060 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1006 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1059 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1191330434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -