BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_L22 (616 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 35 6e-04 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 23 2.0 AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 23 2.7 DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory pro... 21 8.2 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 34.7 bits (76), Expect = 6e-04 Identities = 16/40 (40%), Positives = 28/40 (70%), Gaps = 3/40 (7%) Frame = -2 Query: 594 IGKHVNIINLLGCCTQ---DGPLYVIVEYAPNGNLREFLR 484 + +H I++L+GC T+ +GPL ++VEY G+L+ +LR Sbjct: 507 VRQHPYIVSLIGCVTEGRAEGPL-LVVEYCSRGDLQTYLR 545 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 23.0 bits (47), Expect = 2.0 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -3 Query: 569 TCSAVVHRTGRC 534 TC VHR GRC Sbjct: 93 TCDEPVHRPGRC 104 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 22.6 bits (46), Expect = 2.7 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -2 Query: 108 FNFKKYLIYISLFILVKTRDYNIKLTLWL*IKIS 7 +NF+K+ + L+ ++ Y I LT W I S Sbjct: 27 YNFEKFSLEHQLWQKIQAWTYLILLTTWTVISAS 60 >DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory protein 11 protein. Length = 127 Score = 21.0 bits (42), Expect = 8.2 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -2 Query: 606 NDEMIGKHVNIINLLGCCTQDG 541 +D ++ +VN + G CT DG Sbjct: 39 SDRLLKNYVNCLLEKGKCTPDG 60 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,376 Number of Sequences: 336 Number of extensions: 2977 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15666150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -