BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_L18 (628 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 25 2.6 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 23 6.0 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 24.6 bits (51), Expect = 2.6 Identities = 11/32 (34%), Positives = 23/32 (71%) Frame = -2 Query: 447 FYYKKVS*RFADMYSRIKIQTVIYENYIIYVI 352 FY ++VS ++A++YSR ++ ++ NY + +I Sbjct: 1219 FYIQQVSAQYAEIYSRGPLKN-LHGNYTLELI 1249 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.4 bits (48), Expect = 6.0 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = -2 Query: 582 QSILNEFQ*YCG*KNLKDRSFKTVPVNCSDLFYIPL 475 + +L+E Q +C +++DR+ + CS + IPL Sbjct: 813 KDVLDESQ-FCNETSVRDRNCRQEFCECSHVLQIPL 847 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 552,173 Number of Sequences: 2352 Number of extensions: 9996 Number of successful extensions: 52 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 52 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 52 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61050630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -