BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_L12 (632 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 38 1e-04 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 23 3.3 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 22 5.7 AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 22 5.7 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 7.5 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 37.5 bits (83), Expect = 1e-04 Identities = 17/34 (50%), Positives = 18/34 (52%), Gaps = 3/34 (8%) Frame = +2 Query: 437 CTRNLEPVCASNGVTYNNECMMR---CHGGDHLT 529 C R PVCASNG Y N C + CH G LT Sbjct: 110 CPRRHRPVCASNGKIYANHCELHRAACHSGSSLT 143 Score = 30.3 bits (65), Expect = 0.016 Identities = 24/71 (33%), Positives = 34/71 (47%), Gaps = 8/71 (11%) Frame = +2 Query: 143 ECSRPLAPSLEMKHRG---ECQEVKVADIQPCICTREI----KQVCGSDGVTYGNPCLLN 301 E SR + P K+ G EC+ + I C+C R+ + VC S+G Y N C L+ Sbjct: 74 ESSRSIDPCAS-KYCGIGKECELSPNSTIAVCVCMRKCPRRHRPVCASNGKIYANHCELH 132 Query: 302 -CATQSNPSLS 331 A S SL+ Sbjct: 133 RAACHSGSSLT 143 Score = 25.8 bits (54), Expect = 0.35 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +2 Query: 77 CTFIYAPVCGTDGNTYPNKCSL 142 C + PVC ++G Y N C L Sbjct: 110 CPRRHRPVCASNGKIYANHCEL 131 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 3.3 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 Query: 110 DGNTYPNKCSLECSRPLAPSLEMKHR 187 DGN+Y N CSR + + K R Sbjct: 241 DGNSYRNDGERSCSRDRSREYKKKDR 266 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 21.8 bits (44), Expect = 5.7 Identities = 9/25 (36%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -1 Query: 119 CSRLCHRPGHI*RY-RRKDRLPHTY 48 C RLC+R G + R+ + +P Y Sbjct: 247 CERLCNRLGRVKRFINWHEPIPEAY 271 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 21.8 bits (44), Expect = 5.7 Identities = 10/31 (32%), Positives = 12/31 (38%) Frame = -1 Query: 374 PQPSLCCRKDPGVRCSSSGSTVWRNSTGTGC 282 P PS CR SGS +W+ C Sbjct: 47 PIPSYACRGRCSSYLQVSGSKIWQMERSCMC 77 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.4 bits (43), Expect = 7.5 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -3 Query: 210 TLTSWHSPRCFIS 172 T SWHSP IS Sbjct: 152 TEASWHSPEAHIS 164 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,074 Number of Sequences: 438 Number of extensions: 4195 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18949215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -