BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_L09 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712902-1|CAN84641.1| 95|Tribolium castaneum hypothetical pro... 62 4e-12 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 8.6 AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 21 8.6 >AM712902-1|CAN84641.1| 95|Tribolium castaneum hypothetical protein protein. Length = 95 Score = 61.7 bits (143), Expect = 4e-12 Identities = 32/77 (41%), Positives = 44/77 (57%) Frame = +2 Query: 188 GKNKIHKRSKIKPFVKGVNYNHLMPTRYSVDFSFEKFSAKDLKDPAKRKKLRFNTRVRFE 367 G+ + +R + +P V G + H+ P S K K P KRK++RF TRV+ + Sbjct: 19 GRGQNTQRVQNQPLVIGCDEKHVSPHVIGGITSGGPIPTKSSKYPIKRKRVRFQTRVKVQ 78 Query: 368 ERYKSGKNKWFFQKLRF 418 E KSG+NKWFFQK RF Sbjct: 79 EGSKSGRNKWFFQKGRF 95 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 20.6 bits (41), Expect = 8.6 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +2 Query: 71 AGRKAIVVKNYDEGTSDKP 127 AG+K VK DE +KP Sbjct: 73 AGKKPENVKKEDESDEEKP 91 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 20.6 bits (41), Expect = 8.6 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 221 KPFVKGVNYNHLMPTRYS 274 K F VN HL+ T+Y+ Sbjct: 83 KNFTNIVNLTHLLETQYA 100 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,650 Number of Sequences: 336 Number of extensions: 2507 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -