BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_L07 (649 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 22 4.4 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 4.4 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 4.4 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 7.8 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 22.2 bits (45), Expect = 4.4 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 Query: 170 CRPCVVFLD*GDGSSPTRGPTIQLWR 247 C P VV + SPTR TIQ+W+ Sbjct: 272 CEPQVVIV------SPTRELTIQIWQ 291 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.2 bits (45), Expect = 4.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 45 WKAGVNAGKVLEGLKLYF 98 WK+G N G L G L++ Sbjct: 1424 WKSGHNGGASLTGYTLHY 1441 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.2 bits (45), Expect = 4.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 45 WKAGVNAGKVLEGLKLYF 98 WK+G N G L G L++ Sbjct: 1420 WKSGHNGGASLTGYTLHY 1437 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.4 bits (43), Expect = 7.8 Identities = 12/42 (28%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Frame = -1 Query: 502 CSEAEDTCMLCTTKRSRGALPTIRIPPLSTK---YVSIICSA 386 C E + M + +GA P + P+ST V +C A Sbjct: 1729 CMEKNEAAMKLKKRIEKGANPDLSQKPVSTTEELTVPFVCKA 1770 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 216,557 Number of Sequences: 438 Number of extensions: 5425 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19560480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -