BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_L04 (657 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3H1.06c |||membrane transporter |Schizosaccharomyces pombe|c... 29 0.59 SPAC1399.02 |||membrane transporter|Schizosaccharomyces pombe|ch... 28 1.0 SPBC21D10.09c |||ubiquitin-protein ligase E3 |Schizosaccharomyce... 27 2.4 SPBC530.08 |||transcription factor |Schizosaccharomyces pombe|ch... 27 2.4 SPBC3H7.03c |||2-oxoglutarate dehydrogenase |Schizosaccharomyces... 26 5.5 SPBC16G5.12c |top3||DNA topoisomerase III|Schizosaccharomyces po... 25 7.3 SPBC1604.13c |mrpl32||mitochondrial ribosomal protein subunit L3... 25 9.6 >SPAC3H1.06c |||membrane transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 589 Score = 29.1 bits (62), Expect = 0.59 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = -1 Query: 534 CILGFTLSACFISRTRAVKPSLCSDSLSSTGVVPNVFL 421 CI GF ++ + +RTR + PS +LS T V+ FL Sbjct: 325 CIAGFVVNEFYTTRTRIITPS-AFKTLSLTSVMVTSFL 361 >SPAC1399.02 |||membrane transporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 589 Score = 28.3 bits (60), Expect = 1.0 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -1 Query: 534 CILGFTLSACFISRTRAVKPSLCSDSLSSTGVVPNVFL 421 CI GF ++ + +RTR + PS +LS + V+ FL Sbjct: 325 CIAGFVVNELYTTRTRIIAPS-AFQTLSLSSVMVTSFL 361 >SPBC21D10.09c |||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1610 Score = 27.1 bits (57), Expect = 2.4 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +2 Query: 29 MLPTDLEPALSFCTHLLYKSAGIQADTYKMVSLNENLD 142 M+ +D EP +S C LL + D + MVS E + Sbjct: 1281 MVESDYEPDVSLCPELLSLAIDFPGDPFVMVSKMEKYE 1318 >SPBC530.08 |||transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 815 Score = 27.1 bits (57), Expect = 2.4 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 272 PIKDCTSVDLQCRHHLPLSR 213 P K+C + L+C +H+P SR Sbjct: 46 PCKNCKAGKLECTYHMPSSR 65 >SPBC3H7.03c |||2-oxoglutarate dehydrogenase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1009 Score = 25.8 bits (54), Expect = 5.5 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -3 Query: 616 DNVDQVYDAWDVKVNGAIYVWQ 551 D VD++YDAW N WQ Sbjct: 54 DYVDEMYDAWKKDPNSVHASWQ 75 >SPBC16G5.12c |top3||DNA topoisomerase III|Schizosaccharomyces pombe|chr 2|||Manual Length = 622 Score = 25.4 bits (53), Expect = 7.3 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 Query: 281 QARTAFTNSALLLAEQYGFDGIDLSWQLPK 370 Q T F S+L +A G+D I L W L K Sbjct: 531 QGVTEFVPSSLGVALAKGYDEIGLEWSLTK 560 >SPBC1604.13c |mrpl32||mitochondrial ribosomal protein subunit L32|Schizosaccharomyces pombe|chr 2|||Manual Length = 103 Score = 25.0 bits (52), Expect = 9.6 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 485 ALVREMKQALNVKPNMQLVISVLPNVNCSIYFDVPSIINL 604 AL+R A++ K S LP+++ I+ PSI N+ Sbjct: 2 ALLRGNSLAISQKMLSVFQASALPHISLRIFISPPSIANI 41 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,616,197 Number of Sequences: 5004 Number of extensions: 52101 Number of successful extensions: 169 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 163 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 169 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 297805304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -