Samia BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0002_K24
         (497 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY273815-1|AAQ16156.1| 2623|Homo sapiens bone specific CMF608 pr...    29   6.8  

>AY273815-1|AAQ16156.1| 2623|Homo sapiens bone specific CMF608
            protein.
          Length = 2623

 Score = 29.5 bits (63), Expect = 6.8
 Identities = 21/63 (33%), Positives = 27/63 (42%)
 Frame = +2

Query: 20   LFKDNNEPRAPSTGDHPVLPSIIDDIKLNPHTRYARSLSTPNKYHGGSHTISKSSQSTGP 199
            + KD N     ST +  +L S+      N H    R +S P   H  SHT    S ST P
Sbjct: 927  MIKDVNVKMLSSTTNKLLLESVNTT---NSHQTSVREVSEPRHNHFYSHTTQILSTSTFP 983

Query: 200  THP 208
            + P
Sbjct: 984  SDP 986


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 63,607,107
Number of Sequences: 237096
Number of extensions: 1191060
Number of successful extensions: 2194
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2099
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2194
length of database: 76,859,062
effective HSP length: 85
effective length of database: 56,705,902
effective search space used: 4536472160
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)