BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_K23 (533 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39468| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.34 SB_15021| Best HMM Match : Zona_pellucida (HMM E-Value=0) 31 0.78 SB_48089| Best HMM Match : DUF638 (HMM E-Value=3.3) 30 1.0 SB_54333| Best HMM Match : Glyco_hydro_39 (HMM E-Value=0) 28 4.2 SB_26853| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_34654| Best HMM Match : zf-C2H2 (HMM E-Value=8e-31) 28 5.5 SB_46909| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.00039) 28 5.5 SB_33008| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_47642| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) 27 9.6 SB_30460| Best HMM Match : DSPc (HMM E-Value=2.5e-38) 27 9.6 SB_22524| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_12713| Best HMM Match : TP2 (HMM E-Value=2.9) 27 9.6 >SB_39468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1778 Score = 31.9 bits (69), Expect = 0.34 Identities = 27/97 (27%), Positives = 41/97 (42%), Gaps = 2/97 (2%) Frame = +1 Query: 133 EDQPEQWANSRVRRQAGALTINSDGTSGAMVKVPITGNENHKLSALGSVDLTNQMKLGAA 312 +++P V+ + TIN + +K + GN + L A S N K G Sbjct: 651 DNEPVTETIDSVKEEDSKATINCIRNNNTYIKQSVEGNNSFSLDASSS---ENVRKEGDK 707 Query: 313 TAGLAY-DNVNGHGATLT-KTHIPGFGDKMTAAGKVN 417 ++Y DN+N A T + IPG K + KVN Sbjct: 708 DVVISYSDNMNNSKAANTDQFGIPGSDSKTGSDSKVN 744 >SB_15021| Best HMM Match : Zona_pellucida (HMM E-Value=0) Length = 751 Score = 30.7 bits (66), Expect = 0.78 Identities = 20/58 (34%), Positives = 24/58 (41%), Gaps = 1/58 (1%) Frame = +1 Query: 349 GATLTKTHIPGFGDKMTAAGKVNLFHNNNHDFSAKAFATKNMPNIPQ-VPNFNTVGAG 519 G+T T IPG G + GK ++ N H S A P VP T GAG Sbjct: 322 GSTTKTTKIPGPGKIHISTGKPSITDNTKHKTSPSADGKGGKGEEPTIVPEMTTQGAG 379 >SB_48089| Best HMM Match : DUF638 (HMM E-Value=3.3) Length = 811 Score = 30.3 bits (65), Expect = 1.0 Identities = 21/49 (42%), Positives = 27/49 (55%), Gaps = 6/49 (12%) Frame = -3 Query: 210 GTIRVDSESTRL---PAHPRVSPLLRLILILFD---VVTRLFNKHVTAV 82 G + V+ + RL HPR SPLL+L+ D VV LF +HV AV Sbjct: 614 GKVAVEEKRPRLLRSEFHPRRSPLLQLLSNTPDVHVVVVELFQRHVHAV 662 >SB_54333| Best HMM Match : Glyco_hydro_39 (HMM E-Value=0) Length = 1325 Score = 28.3 bits (60), Expect = 4.2 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -3 Query: 237 YGYLDHSTGGTIRVDSESTRLPAHPRVSPL 148 Y YL H T T + DS STR+ RV L Sbjct: 935 YAYLHHDTRTTCKYDSYSTRIYTATRVRQL 964 >SB_26853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 771 Score = 28.3 bits (60), Expect = 4.2 Identities = 20/61 (32%), Positives = 26/61 (42%) Frame = +1 Query: 328 YDNVNGHGATLTKTHIPGFGDKMTAAGKVNLFHNNNHDFSAKAFATKNMPNIPQVPNFNT 507 Y NGH L ++ P T V F NN+DFS++ A N PN+ F Sbjct: 273 YTPTNGH-FQLDESVFPNSDSPDTRDQTVESFEINNNDFSSQENAQSN-PNLDNNDRFRP 330 Query: 508 V 510 V Sbjct: 331 V 331 >SB_34654| Best HMM Match : zf-C2H2 (HMM E-Value=8e-31) Length = 624 Score = 27.9 bits (59), Expect = 5.5 Identities = 24/96 (25%), Positives = 39/96 (40%), Gaps = 2/96 (2%) Frame = +1 Query: 103 EEPGYYIEQYE--DQPEQWANSRVRRQAGALTINSDGTSGAMVKVPITGNENHKLSALGS 276 E Y E+YE D AN QA + N+ ++G ++ + ++G + K+ A S Sbjct: 113 ERSEYGGERYETSDFQRSVANRYKELQADSWKKNNVTSAGGLLSLDLSGEGHFKVHANAS 172 Query: 277 VDLTNQMKLGAATAGLAYDNVNGHGATLTKTHIPGF 384 + + Y + A L HIPGF Sbjct: 173 TAIPAAETTDWPQENI-YSTIQYQEAPLPPAHIPGF 207 >SB_46909| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.00039) Length = 685 Score = 27.9 bits (59), Expect = 5.5 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -1 Query: 293 WLVRSTEPRALSLWFSLPVMGTLTIAPEVPSELIV 189 W+V ++EP LS + ++ T +I P P I+ Sbjct: 472 WVVETSEPLQLSTTIMISIITTTSILPSFPPTAII 506 >SB_33008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1016 Score = 27.5 bits (58), Expect = 7.3 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -3 Query: 279 D*TKSTELVVFIASYGYLDHSTGGTIRVDSES 184 D +K+ E + IA++ L+H+ G I DSES Sbjct: 800 DLSKALEDIKNIAAFNVLEHAKSGEIESDSES 831 >SB_47642| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) Length = 1336 Score = 27.1 bits (57), Expect = 9.6 Identities = 22/87 (25%), Positives = 37/87 (42%) Frame = +1 Query: 85 SRYVLVEEPGYYIEQYEDQPEQWANSRVRRQAGALTINSDGTSGAMVKVPITGNENHKLS 264 +R + EP ++ EDQ E A+S +R +AG +D G + + T N NH Sbjct: 1183 ARKAQINEPPSPLKVQEDQRETEAHSPIRTRAGREATCNDHLKGCVNQA--TCN-NHLKG 1239 Query: 265 ALGSVDLTNQMKLGAATAGLAYDNVNG 345 + + +K G D++ G Sbjct: 1240 CVNQATCNDHLK-GCVNQATCNDHLKG 1265 >SB_30460| Best HMM Match : DSPc (HMM E-Value=2.5e-38) Length = 550 Score = 27.1 bits (57), Expect = 9.6 Identities = 27/90 (30%), Positives = 40/90 (44%), Gaps = 2/90 (2%) Frame = +1 Query: 214 GAMVKVPITGNENHKLSALGSVDLTNQMKLGAATAGLAYDNVNGHGATLTKTHIPGFGDK 393 G V +T E +L ALG +T+ + T L++ N + A+ K+ I G Sbjct: 401 GIYVGGAVTAMEEDQLVALG---VTHVLNAAQGTKRLSHVNTD---ASFYKSGIIFHGIP 454 Query: 394 MTAAG--KVNLFHNNNHDFSAKAFATKNMP 477 T K+N + + DF A A TKN P Sbjct: 455 ATDVFMFKLNKYFDEAADFIASAVGTKNCP 484 >SB_22524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 353 Score = 27.1 bits (57), Expect = 9.6 Identities = 13/29 (44%), Positives = 20/29 (68%), Gaps = 3/29 (10%) Frame = +1 Query: 382 FGDKMTAAG---KVNLFHNNNHDFSAKAF 459 F ++ T++G KV LFH N+ F+AK+F Sbjct: 35 FAEQDTSSGLTTKVCLFHGKNNPFTAKSF 63 >SB_12713| Best HMM Match : TP2 (HMM E-Value=2.9) Length = 349 Score = 27.1 bits (57), Expect = 9.6 Identities = 20/87 (22%), Positives = 38/87 (43%) Frame = +1 Query: 247 ENHKLSALGSVDLTNQMKLGAATAGLAYDNVNGHGATLTKTHIPGFGDKMTAAGKVNLFH 426 +N+K S D ++ K A T+GLA + +G ++P +++ K N Sbjct: 83 DNYKKKKTKSKDNNSETKAKAGTSGLAKNKTKDNGT----PNLPSLFERIK---KKNNAT 135 Query: 427 NNNHDFSAKAFATKNMPNIPQVPNFNT 507 N S + P +P++ +F+T Sbjct: 136 KNGETTSQVTINSSGTPALPKLASFDT 162 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.316 0.132 0.386 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,337,495 Number of Sequences: 59808 Number of extensions: 326342 Number of successful extensions: 685 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 631 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 685 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1203486867 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -