BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_K22 (282 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC032645-1|AAH32645.1| 445|Homo sapiens chromosome 10 open read... 29 3.6 AK023552-1|BAB14609.1| 445|Homo sapiens protein ( Homo sapiens ... 29 3.6 >BC032645-1|AAH32645.1| 445|Homo sapiens chromosome 10 open reading frame 88 protein. Length = 445 Score = 28.7 bits (61), Expect = 3.6 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +3 Query: 123 CKITIETFGD*SCI-VESLTPYLRSSVGGSDVSSLAFLGSSVGL 251 CKI + +FG+ C+ + + ++RS S SS A LGS + L Sbjct: 144 CKIKLLSFGERQCVFISKVVVHMRSVFANSSTSSPA-LGSRIDL 186 >AK023552-1|BAB14609.1| 445|Homo sapiens protein ( Homo sapiens cDNA FLJ13490 fis, clone PLACE1004118. ). Length = 445 Score = 28.7 bits (61), Expect = 3.6 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +3 Query: 123 CKITIETFGD*SCI-VESLTPYLRSSVGGSDVSSLAFLGSSVGL 251 CKI + +FG+ C+ + + ++RS S SS A LGS + L Sbjct: 144 CKIKLLSFGERQCVFISKVVVHMRSVFANSSTSSPA-LGSRIDL 186 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 35,169,413 Number of Sequences: 237096 Number of extensions: 578693 Number of successful extensions: 5039 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5030 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5039 length of database: 76,859,062 effective HSP length: 70 effective length of database: 60,262,342 effective search space used: 1386033866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -