BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_K18 (614 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 23 2.7 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 22 3.6 DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 22 4.7 AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 21 8.2 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 21 8.2 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 22.6 bits (46), Expect = 2.7 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -2 Query: 136 VLHNSTNNFNCVNCSSLKGQLIMKIGI 56 VL+ S +F + C+SL KIGI Sbjct: 62 VLYTSLTSFGYLFCASLSFYKAFKIGI 88 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 22.2 bits (45), Expect = 3.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +3 Query: 186 LGSLGVTIPTATFG 227 LGS+GV++P T G Sbjct: 219 LGSMGVSVPCGTSG 232 >DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory protein 15 protein. Length = 146 Score = 21.8 bits (44), Expect = 4.7 Identities = 10/36 (27%), Positives = 16/36 (44%) Frame = -3 Query: 435 QTDLVPHR*LPLSCHPLADYYPRSRLLLLHPYQVPH 328 +T PH + L + + P + L H +Q PH Sbjct: 100 ETKFNPHHEIKLQHLHQSKFNPHEEVKLQHLHQFPH 135 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 21.0 bits (42), Expect = 8.2 Identities = 10/44 (22%), Positives = 22/44 (50%) Frame = +1 Query: 151 YIIQNWYSSKNILDRLGSQYPLLHLVLKASHLPETATLLLTMLR 282 +++ YSS +LD + L+ L+L+ + +L +L+ Sbjct: 282 FLLFTLYSSLLLLDYVSCVVALIILILQCGRVRSEVVKILNVLK 325 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 21.0 bits (42), Expect = 8.2 Identities = 10/44 (22%), Positives = 22/44 (50%) Frame = +1 Query: 151 YIIQNWYSSKNILDRLGSQYPLLHLVLKASHLPETATLLLTMLR 282 +++ YSS +LD + L+ L+L+ + +L +L+ Sbjct: 208 FLLFTLYSSLLLLDYVSCVVALIILILQCGRVRSEVVKILNVLK 251 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,360 Number of Sequences: 336 Number of extensions: 2597 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15666150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -