BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_K17 (652 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 25 2.7 Z69981-1|CAA93821.1| 327|Anopheles gambiae maltase precursor pr... 24 4.8 DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist mic... 23 6.3 AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. 23 8.4 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 24.6 bits (51), Expect = 2.7 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -3 Query: 506 IRSLSLSTENPAGSLGGYTIFSEWYNLKLT 417 I+ +SL+ P GS+ G T+++ YN LT Sbjct: 592 IKKMSLTAGVPQGSILGPTLWNVMYNGVLT 621 >Z69981-1|CAA93821.1| 327|Anopheles gambiae maltase precursor protein. Length = 327 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 Query: 529 ERIAAMNITLAKIDGANAVEEAPEI 603 ERI A+N+ L + GA+ + EI Sbjct: 100 ERIDALNMVLLSLSGASVTYQGEEI 124 >DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist michelob_x protein. Length = 201 Score = 23.4 bits (48), Expect = 6.3 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 66 YCKRKISHFCRCFKR 110 YC+ HF RCF R Sbjct: 168 YCRNISHHFLRCFYR 182 >AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. Length = 391 Score = 23.0 bits (47), Expect = 8.4 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -3 Query: 506 IRSLSLSTENPAGSLGGYTIFSE 438 IR S + +PAGSLGG + S+ Sbjct: 81 IRWRSQNPASPAGSLGGKDVVSK 103 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 631,547 Number of Sequences: 2352 Number of extensions: 12161 Number of successful extensions: 13 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -