BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_K16 (349 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1840.05c |||phosphomannomutase |Schizosaccharomyces pombe|ch... 29 0.27 SPBC16A3.13 |meu7|aah4|alpha-amylase homolog Aah4|Schizosaccharo... 25 3.4 SPBC2F12.02c |mrpl7||mitochondrial ribosomal protein subunit L7|... 25 4.4 SPCC1840.03 |sal3|pse1|karyopherin Sal3|Schizosaccharomyces pomb... 24 7.8 >SPCC1840.05c |||phosphomannomutase |Schizosaccharomyces pombe|chr 3|||Manual Length = 587 Score = 28.7 bits (61), Expect = 0.27 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -2 Query: 261 LSFSQ*NSHGFSYVLPSDPQTGL*IFPQIHNGGGRAVT 148 L++ Q +++G SYVL +DP F + NG R T Sbjct: 289 LAYEQADANGISYVLATDPDADRFAFAEKINGAWRRFT 326 >SPBC16A3.13 |meu7|aah4|alpha-amylase homolog Aah4|Schizosaccharomyces pombe|chr 2|||Manual Length = 774 Score = 25.0 bits (52), Expect = 3.4 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 7/29 (24%) Frame = +1 Query: 277 DNREKHRMRGGHPLLLY-------LGICP 342 DNR+ +R G P++LY +G+CP Sbjct: 697 DNRQVFMVRNGEPMILYPEESAYEMGLCP 725 >SPBC2F12.02c |mrpl7||mitochondrial ribosomal protein subunit L7|Schizosaccharomyces pombe|chr 2|||Manual Length = 287 Score = 24.6 bits (51), Expect = 4.4 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 262 DTQQYDNREKHRMRGGHPLL 321 D Y NR +MRG PLL Sbjct: 94 DNPYYKNRPPQKMRGNKPLL 113 >SPCC1840.03 |sal3|pse1|karyopherin Sal3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1095 Score = 23.8 bits (49), Expect = 7.8 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 185 FRKYITAVAELLPSILAQRRSEEYR 111 F KY A+ LL ++L Q +E+R Sbjct: 531 FEKYFDAIMPLLFNVLQQADGKEFR 555 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,450,910 Number of Sequences: 5004 Number of extensions: 28493 Number of successful extensions: 74 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 74 length of database: 2,362,478 effective HSP length: 64 effective length of database: 2,042,222 effective search space used: 104153322 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -