BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_K16 (349 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014134-2104|AAN10788.1| 79|Drosophila melanogaster CG31758-P... 42 2e-04 AY058325-1|AAL13554.1| 662|Drosophila melanogaster GH09510p pro... 40 9e-04 AE014296-1453|AAF50418.2| 662|Drosophila melanogaster CG32354-P... 40 9e-04 BT023691-1|AAY85091.1| 68|Drosophila melanogaster IP03664p pro... 39 0.002 AE014134-2103|AAN10787.1| 68|Drosophila melanogaster CG31704-P... 39 0.002 AY075472-1|AAL68284.1| 692|Drosophila melanogaster RE32029p pro... 35 0.025 AE014134-1125|AAG22419.2| 692|Drosophila melanogaster CG31634-P... 35 0.025 AY052138-1|AAK93562.1| 1071|Drosophila melanogaster SD09502p pro... 35 0.033 AE014296-2453|AAF49684.2| 1071|Drosophila melanogaster CG5392-PA... 35 0.033 AE014134-1648|AAS64665.1| 1136|Drosophila melanogaster CG3811-PD... 33 0.099 AE014134-1647|AAS64664.1| 1197|Drosophila melanogaster CG3811-PC... 33 0.099 AE014134-1646|AAN10695.1| 1197|Drosophila melanogaster CG3811-PB... 33 0.099 AE014134-1645|AAF52781.2| 1197|Drosophila melanogaster CG3811-PA... 33 0.099 BT023942-1|ABB36446.1| 789|Drosophila melanogaster LP09443p pro... 32 0.17 AY047504-1|AAK77236.1| 698|Drosophila melanogaster GH01304p pro... 32 0.17 AE013599-3367|AAF46826.1| 789|Drosophila melanogaster CG3380-PA... 32 0.17 AE014134-2105|AAF53126.1| 77|Drosophila melanogaster CG14933-P... 32 0.23 BT030425-1|ABO52845.1| 684|Drosophila melanogaster IP17768p pro... 31 0.30 AE013599-3365|AAF46824.2| 631|Drosophila melanogaster CG30277-P... 31 0.30 BT003621-1|AAO39624.1| 767|Drosophila melanogaster GH04473p pro... 30 0.93 AF454393-1|AAL51006.1| 705|Drosophila melanogaster follistatin ... 30 0.93 AE014297-408|AAF51914.1| 730|Drosophila melanogaster CG1077-PA ... 30 0.93 AE013599-2026|AAF58158.2| 767|Drosophila melanogaster CG33466-P... 30 0.93 AY069042-1|AAL39187.1| 114|Drosophila melanogaster GH03839p pro... 29 1.2 AE014298-1831|AAF48217.1| 843|Drosophila melanogaster CG15721-P... 29 1.2 AE014296-51|AAF47354.2| 98|Drosophila melanogaster CG1220-PG, ... 29 1.2 AE014296-50|AAN11429.1| 97|Drosophila melanogaster CG1220-PC, ... 29 1.2 AE014296-49|AAN11428.1| 115|Drosophila melanogaster CG1220-PH, ... 29 1.2 AE014296-48|AAN11427.1| 114|Drosophila melanogaster CG1220-PF, ... 29 1.2 AE014296-47|AAG22218.2| 114|Drosophila melanogaster CG1220-PE, ... 29 1.2 AE014296-46|AAF47353.1| 114|Drosophila melanogaster CG1220-PA, ... 29 1.2 AB017976-1|BAA75790.1| 115|Drosophila melanogaster KAZ1-type se... 29 1.2 AB017975-1|BAA75789.1| 97|Drosophila melanogaster KAZ1-type se... 29 1.2 AB017974-1|BAA75788.1| 114|Drosophila melanogaster KAZ1-type se... 29 1.2 AB017973-1|BAA75787.1| 114|Drosophila melanogaster KAZ1-type se... 29 1.2 AB017972-1|BAA75786.1| 114|Drosophila melanogaster KAZ1-type se... 29 1.2 AB017699-2|BAA75687.1| 98|Drosophila melanogaster protease inh... 29 1.2 AY906258-1|AAX60604.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906257-1|AAX60603.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906256-1|AAX60602.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906255-1|AAX60601.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906254-1|AAX60600.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906253-1|AAX60599.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906252-1|AAX60598.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906251-1|AAX60597.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906250-1|AAX60596.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906249-1|AAX60595.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906248-1|AAX60594.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906247-1|AAX60593.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906246-1|AAX60592.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906245-1|AAX60591.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906244-1|AAX60590.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906243-1|AAX60589.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906242-1|AAX60588.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906241-1|AAX60587.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906240-1|AAX60586.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906239-1|AAX60585.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906238-1|AAX60584.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906237-1|AAX60583.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906236-1|AAX60582.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906235-1|AAX60581.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906234-1|AAX60580.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906233-1|AAX60579.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906232-1|AAX60578.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906231-1|AAX60577.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906230-1|AAX60576.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906229-1|AAX60575.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906228-1|AAX60574.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906227-1|AAX60573.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906226-1|AAX60572.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906225-1|AAX60571.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906224-1|AAX60570.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906223-1|AAX60569.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906222-1|AAX60568.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906221-1|AAX60567.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906220-1|AAX60566.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906219-1|AAX60565.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906218-1|AAX60564.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906217-1|AAX60563.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906216-1|AAX60562.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906215-1|AAX60561.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906214-1|AAX60560.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906213-1|AAX60559.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906212-1|AAX60558.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906211-1|AAX60557.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906210-1|AAX60556.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906209-1|AAX60555.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906208-1|AAX60554.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906207-1|AAX60553.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906206-1|AAX60552.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906205-1|AAX60551.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906204-1|AAX60550.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906203-1|AAX60549.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906202-1|AAX60548.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906201-1|AAX60547.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906200-1|AAX60546.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906199-1|AAX60545.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906198-1|AAX60544.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906197-1|AAX60543.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906196-1|AAX60542.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906195-1|AAX60541.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906194-1|AAX60540.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906193-1|AAX60539.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906192-1|AAX60538.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906191-1|AAX60537.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906190-1|AAX60536.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906189-1|AAX60535.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906188-1|AAX60534.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906187-1|AAX60533.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906186-1|AAX60532.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906185-1|AAX60531.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906184-1|AAX60530.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906183-1|AAX60529.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906182-1|AAX60528.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906181-1|AAX60527.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906180-1|AAX60526.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906179-1|AAX60525.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906178-1|AAX60524.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906177-1|AAX60523.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906176-1|AAX60522.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906175-1|AAX60521.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906174-1|AAX60520.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906173-1|AAX60519.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906172-1|AAX60518.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906171-1|AAX60517.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906170-1|AAX60516.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906169-1|AAX60515.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906168-1|AAX60514.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906167-1|AAX60513.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906166-1|AAX60512.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906165-1|AAX60511.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906164-1|AAX60510.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906163-1|AAX60509.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906162-1|AAX60508.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906161-1|AAX60507.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906160-1|AAX60506.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906159-1|AAX60505.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906158-1|AAX60504.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906157-1|AAX60503.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906156-1|AAX60502.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906155-1|AAX60501.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906154-1|AAX60500.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906153-1|AAX60499.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906152-1|AAX60498.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906151-1|AAX60497.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906150-1|AAX60496.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906149-1|AAX60495.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906148-1|AAX60494.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906147-1|AAX60493.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906146-1|AAX60492.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906145-1|AAX60491.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906144-1|AAX60490.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906143-1|AAX60489.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906142-1|AAX60488.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906141-1|AAX60487.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906140-1|AAX60486.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906139-1|AAX60485.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906138-1|AAX60484.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906137-1|AAX60483.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906136-1|AAX60482.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906135-1|AAX60481.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906134-1|AAX60480.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906133-1|AAX60479.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906132-1|AAX60478.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906131-1|AAX60477.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906130-1|AAX60476.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906129-1|AAX60475.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906128-1|AAX60474.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906127-1|AAX60473.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906126-1|AAX60472.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906125-1|AAX60471.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906124-1|AAX60470.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906123-1|AAX60469.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906122-1|AAX60468.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906121-1|AAX60467.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906120-1|AAX60466.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906119-1|AAX60465.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906118-1|AAX60464.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906117-1|AAX60463.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906116-1|AAX60462.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906115-1|AAX60461.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906114-1|AAX60460.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906113-1|AAX60459.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906112-1|AAX60458.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906111-1|AAX60457.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906110-1|AAX60456.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906109-1|AAX60455.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906108-1|AAX60454.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906107-1|AAX60453.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906106-1|AAX60452.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906105-1|AAX60451.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906104-1|AAX60450.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906103-1|AAX60449.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906102-1|AAX60448.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906101-1|AAX60447.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906100-1|AAX60446.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906099-1|AAX60445.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906098-1|AAX60444.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906096-1|AAX60442.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906095-1|AAX60441.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906094-1|AAX60440.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906093-1|AAX60439.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906092-1|AAX60438.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906091-1|AAX60437.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906090-1|AAX60436.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906089-1|AAX60435.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906088-1|AAX60434.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906087-1|AAX60433.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906086-1|AAX60432.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906085-1|AAX60431.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906084-1|AAX60430.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906083-1|AAX60429.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906082-1|AAX60428.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906081-1|AAX60427.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906080-1|AAX60426.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906079-1|AAX60425.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906078-1|AAX60424.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906077-1|AAX60423.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906076-1|AAX60422.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906075-1|AAX60421.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906074-1|AAX60420.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906073-1|AAX60419.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906072-1|AAX60418.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906071-1|AAX60417.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906070-1|AAX60416.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906069-1|AAX60415.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906068-1|AAX60414.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906067-1|AAX60413.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906066-1|AAX60412.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906065-1|AAX60411.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906064-1|AAX60410.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906063-1|AAX60409.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906062-1|AAX60408.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906061-1|AAX60407.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906060-1|AAX60406.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906059-1|AAX60405.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906058-1|AAX60404.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906057-1|AAX60403.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906056-1|AAX60402.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906055-1|AAX60401.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906054-1|AAX60400.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906053-1|AAX60399.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906052-1|AAX60398.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906051-1|AAX60397.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906050-1|AAX60396.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906049-1|AAX60395.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906048-1|AAX60394.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906047-1|AAX60393.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906046-1|AAX60392.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906045-1|AAX60391.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906044-1|AAX60390.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906043-1|AAX60389.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906042-1|AAX60388.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906041-1|AAX60387.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906040-1|AAX60386.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906039-1|AAX60385.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906038-1|AAX60384.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906037-1|AAX60383.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906036-1|AAX60382.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906035-1|AAX60381.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906034-1|AAX60380.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906033-1|AAX60379.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906032-1|AAX60378.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906031-1|AAX60377.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906030-1|AAX60376.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906029-1|AAX60375.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906028-1|AAX60374.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906027-1|AAX60373.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906026-1|AAX60372.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906025-1|AAX60371.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906024-1|AAX60370.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906023-1|AAX60369.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906022-1|AAX60368.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906021-1|AAX60367.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906020-1|AAX60366.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906019-1|AAX60365.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906018-1|AAX60364.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906017-1|AAX60363.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906016-1|AAX60362.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906015-1|AAX60361.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906014-1|AAX60360.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906013-1|AAX60359.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906012-1|AAX60358.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906011-1|AAX60357.1| 55|Drosophila melanogaster enhancer of ... 29 1.6 AY906010-1|AAX60356.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906009-1|AAX60355.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906008-1|AAX60354.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906007-1|AAX60353.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906006-1|AAX60352.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906005-1|AAX60351.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906004-1|AAX60350.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906003-1|AAX60349.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906002-1|AAX60348.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906001-1|AAX60347.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY906000-1|AAX60346.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905999-1|AAX60345.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905998-1|AAX60344.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905997-1|AAX60343.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905996-1|AAX60342.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905995-1|AAX60341.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905994-1|AAX60340.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905993-1|AAX60339.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905992-1|AAX60338.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905991-1|AAX60337.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905990-1|AAX60336.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905989-1|AAX60335.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905988-1|AAX60334.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905987-1|AAX60333.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905986-1|AAX60332.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905985-1|AAX60331.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905984-1|AAX60330.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905983-1|AAX60329.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905982-1|AAX60328.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905981-1|AAX60327.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905980-1|AAX60326.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905979-1|AAX60325.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905978-1|AAX60324.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905976-1|AAX60322.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905975-1|AAX60321.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905974-1|AAX60320.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905973-1|AAX60319.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905972-1|AAX60318.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905971-1|AAX60317.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905970-1|AAX60316.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905969-1|AAX60315.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905968-1|AAX60314.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905967-1|AAX60313.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905966-1|AAX60312.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905965-1|AAX60311.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905964-1|AAX60310.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905963-1|AAX60309.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905962-1|AAX60308.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905961-1|AAX60307.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905960-1|AAX60306.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905959-1|AAX60305.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905958-1|AAX60304.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905957-1|AAX60303.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905956-1|AAX60302.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905955-1|AAX60301.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905954-1|AAX60300.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905953-1|AAX60299.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905952-1|AAX60298.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905951-1|AAX60297.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905950-1|AAX60296.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905949-1|AAX60295.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905948-1|AAX60294.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905947-1|AAX60293.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905946-1|AAX60292.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905945-1|AAX60291.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905944-1|AAX60290.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905943-1|AAX60289.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905942-1|AAX60288.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905941-1|AAX60287.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905940-1|AAX60286.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905939-1|AAX60285.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905938-1|AAX60284.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905937-1|AAX60283.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905936-1|AAX60282.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905935-1|AAX60281.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905934-1|AAX60280.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905933-1|AAX60279.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905932-1|AAX60278.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905931-1|AAX60277.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905930-1|AAX60276.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905929-1|AAX60275.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905928-1|AAX60274.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905927-1|AAX60273.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905926-1|AAX60272.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905925-1|AAX60271.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905924-1|AAX60270.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905923-1|AAX60269.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905922-1|AAX60268.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905921-1|AAX60267.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905920-1|AAX60266.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905919-1|AAX60265.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905918-1|AAX60264.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905917-1|AAX60263.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905916-1|AAX60262.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905915-1|AAX60261.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905914-1|AAX60260.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905913-1|AAX60259.1| 69|Drosophila melanogaster enhancer of ... 29 1.6 AY905912-1|AAX60258.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905911-1|AAX60257.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905910-1|AAX60256.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905909-1|AAX60255.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905908-1|AAX60254.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905907-1|AAX60253.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905906-1|AAX60252.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905905-1|AAX60251.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905904-1|AAX60250.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905903-1|AAX60249.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905902-1|AAX60248.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905901-1|AAX60247.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY905900-1|AAX60246.1| 70|Drosophila melanogaster enhancer of ... 29 1.6 AY779921-5|AAV59233.1| 156|Drosophila melanogaster enhancer of ... 29 1.6 AY779920-5|AAV59221.1| 156|Drosophila melanogaster enhancer of ... 29 1.6 AY779919-5|AAV59209.1| 156|Drosophila melanogaster enhancer of ... 29 1.6 AY779918-5|AAV59197.1| 156|Drosophila melanogaster enhancer of ... 29 1.6 AY779917-5|AAV59185.1| 156|Drosophila melanogaster enhancer of ... 29 1.6 AY779916-5|AAV59173.1| 156|Drosophila melanogaster enhancer of ... 29 1.6 AY779915-5|AAV59161.1| 156|Drosophila melanogaster enhancer of ... 29 1.6 AY779914-5|AAV59149.1| 156|Drosophila melanogaster enhancer of ... 29 1.6 AY779913-5|AAV59137.1| 156|Drosophila melanogaster enhancer of ... 29 1.6 AY779912-5|AAV59125.1| 156|Drosophila melanogaster enhancer of ... 29 1.6 AY779911-5|AAV59113.1| 156|Drosophila melanogaster enhancer of ... 29 1.6 AY779910-5|AAV59101.1| 156|Drosophila melanogaster enhancer of ... 29 1.6 AY779909-5|AAV59089.1| 156|Drosophila melanogaster enhancer of ... 29 1.6 AY779908-5|AAV59077.1| 156|Drosophila melanogaster enhancer of ... 29 1.6 AY779907-5|AAV59065.1| 156|Drosophila melanogaster enhancer of ... 29 1.6 AY779906-5|AAV59053.1| 156|Drosophila melanogaster enhancer of ... 29 1.6 AY113480-1|AAM29485.1| 156|Drosophila melanogaster RE44854p pro... 29 1.6 AJ010167-1|CAB39163.1| 156|Drosophila melanogaster M1 protein p... 29 1.6 AE014297-3896|AAF56548.1| 156|Drosophila melanogaster CG8342-PA... 29 1.6 AE013599-3366|AAF46825.1| 727|Drosophila melanogaster CG3382-PA... 29 1.6 M97259-1|AAA28497.1| 341|Drosophila melanogaster ecdysone-induc... 29 2.1 BT012464-1|AAS93735.1| 340|Drosophila melanogaster RE44872p pro... 29 2.1 AY069742-1|AAL39887.2| 372|Drosophila melanogaster LP07125p pro... 29 2.1 AE014296-2263|AAF49828.1| 341|Drosophila melanogaster CG10717-P... 29 2.1 AE014296-2262|AAN11832.1| 366|Drosophila melanogaster CG10717-P... 29 2.1 X15008-1|CAA33113.1| 414|Drosophila melanogaster TU-36B protein... 28 2.8 BT001436-1|AAN71191.1| 819|Drosophila melanogaster GH24467p pro... 28 2.8 AY242076-1|AAO85264.1| 523|Drosophila melanogaster CG2264A prot... 28 2.8 AY058615-1|AAL13844.1| 613|Drosophila melanogaster LD30894p pro... 28 2.8 AE014296-2920|AAF49332.2| 819|Drosophila melanogaster CG7571-PA... 28 2.8 AE013599-1003|AAM71054.1| 613|Drosophila melanogaster CG2264-PE... 28 2.8 AE013599-1002|AAM71053.1| 613|Drosophila melanogaster CG2264-PD... 28 2.8 AE013599-1001|AAM71052.1| 613|Drosophila melanogaster CG2264-PC... 28 2.8 AE013599-1000|AAF58854.1| 613|Drosophila melanogaster CG2264-PB... 28 2.8 AE013599-999|AAG22291.1| 613|Drosophila melanogaster CG2264-PA,... 28 2.8 AY122164-1|AAM52676.1| 570|Drosophila melanogaster LD23744p pro... 28 3.7 AE014296-3574|AAF51745.1| 564|Drosophila melanogaster CG7173-PA... 28 3.7 AY071008-1|AAL48630.1| 814|Drosophila melanogaster RE09129p pro... 27 4.9 AE014296-3216|ABI31263.1| 211|Drosophila melanogaster CG34116-P... 27 4.9 AE014134-2208|AAF53197.2| 814|Drosophila melanogaster CG6417-PA... 27 4.9 AE014298-1830|AAN09644.1| 582|Drosophila melanogaster CG32644-P... 27 8.6 AE014296-59|ABC66118.1| 423|Drosophila melanogaster CG34018-PA ... 27 8.6 AE014134-2040|AAF53079.3| 1163|Drosophila melanogaster CG33114-P... 27 8.6 >AE014134-2104|AAN10788.1| 79|Drosophila melanogaster CG31758-PA protein. Length = 79 Score = 41.9 bits (94), Expect = 2e-04 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = +2 Query: 167 PLCICGKIYSPVCGSDGKTYENPCEFYC 250 P+C C + Y PVCGS+ TY N CEF C Sbjct: 32 PICPCPRNYEPVCGSNLVTYPNRCEFDC 59 >AY058325-1|AAL13554.1| 662|Drosophila melanogaster GH09510p protein. Length = 662 Score = 39.9 bits (89), Expect = 9e-04 Identities = 27/68 (39%), Positives = 35/68 (51%), Gaps = 6/68 (8%) Frame = +2 Query: 164 PPLCICGKIYSPVCGSDGKTYENPCEFYCEKDKTHSNMTIVKNT--GCE--VGIPC--YC 325 PP G PVCGSDG Y N CE +K + S ++++K+ GCE G C C Sbjct: 169 PPSITVGA--EPVCGSDGLIYANICELR-KKTCSRSGVSLIKDVRDGCERSKGSDCKHRC 225 Query: 326 TLEYAPVC 349 + E PVC Sbjct: 226 STEKDPVC 233 Score = 38.3 bits (85), Expect = 0.003 Identities = 17/39 (43%), Positives = 23/39 (58%) Frame = +2 Query: 176 ICGKIYSPVCGSDGKTYENPCEFYCEKDKTHSNMTIVKN 292 IC + + PVCGSD KTY N C + E + +N T+ N Sbjct: 609 ICPREFEPVCGSDNKTYLNDC--FLEIENCRANQTVNVN 645 Score = 33.1 bits (72), Expect = 0.099 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYENPCE 241 C ++ P CGSDG+ Y +PC+ Sbjct: 330 CWRVARPTCGSDGRLYASPCK 350 Score = 31.5 bits (68), Expect = 0.30 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +2 Query: 197 PVCGSDGKTYENPCEF 244 PVCGSDG T+ + CEF Sbjct: 516 PVCGSDGNTFASMCEF 531 Score = 30.7 bits (66), Expect = 0.53 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYENPC 238 C PVCG+DG+TY N C Sbjct: 225 CSTEKDPVCGTDGRTYLNRC 244 Score = 27.9 bits (59), Expect = 3.7 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 Query: 200 VCGSDGKTYENPCE 241 +CG+D KTY N CE Sbjct: 462 LCGTDAKTYNNECE 475 Score = 27.1 bits (57), Expect = 6.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 197 PVCGSDGKTYENPCE 241 PVC SDG Y + CE Sbjct: 288 PVCSSDGNVYNSTCE 302 >AE014296-1453|AAF50418.2| 662|Drosophila melanogaster CG32354-PA protein. Length = 662 Score = 39.9 bits (89), Expect = 9e-04 Identities = 27/68 (39%), Positives = 35/68 (51%), Gaps = 6/68 (8%) Frame = +2 Query: 164 PPLCICGKIYSPVCGSDGKTYENPCEFYCEKDKTHSNMTIVKNT--GCE--VGIPC--YC 325 PP G PVCGSDG Y N CE +K + S ++++K+ GCE G C C Sbjct: 169 PPSITVGA--EPVCGSDGLIYANICELR-KKTCSRSGVSLIKDVRDGCERSKGSDCKHRC 225 Query: 326 TLEYAPVC 349 + E PVC Sbjct: 226 STEKDPVC 233 Score = 38.3 bits (85), Expect = 0.003 Identities = 17/39 (43%), Positives = 23/39 (58%) Frame = +2 Query: 176 ICGKIYSPVCGSDGKTYENPCEFYCEKDKTHSNMTIVKN 292 IC + + PVCGSD KTY N C + E + +N T+ N Sbjct: 609 ICPREFEPVCGSDNKTYLNDC--FLEIENCRANQTVNVN 645 Score = 33.1 bits (72), Expect = 0.099 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYENPCE 241 C ++ P CGSDG+ Y +PC+ Sbjct: 330 CWRVARPTCGSDGRLYASPCK 350 Score = 31.5 bits (68), Expect = 0.30 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +2 Query: 197 PVCGSDGKTYENPCEF 244 PVCGSDG T+ + CEF Sbjct: 516 PVCGSDGNTFASMCEF 531 Score = 30.7 bits (66), Expect = 0.53 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYENPC 238 C PVCG+DG+TY N C Sbjct: 225 CSTEKDPVCGTDGRTYLNRC 244 Score = 27.9 bits (59), Expect = 3.7 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 Query: 200 VCGSDGKTYENPCE 241 +CG+D KTY N CE Sbjct: 462 LCGTDAKTYNNECE 475 Score = 27.1 bits (57), Expect = 6.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 197 PVCGSDGKTYENPCE 241 PVC SDG Y + CE Sbjct: 288 PVCSSDGNVYNSTCE 302 >BT023691-1|AAY85091.1| 68|Drosophila melanogaster IP03664p protein. Length = 68 Score = 38.7 bits (86), Expect = 0.002 Identities = 18/43 (41%), Positives = 22/43 (51%) Frame = +2 Query: 173 CICGKIYSPVCGSDGKTYENPCEFYCEKDKTHSNMTIVKNTGC 301 C C + Y PVCGSD TY N C C K ++T+ K C Sbjct: 27 CPCPRNYDPVCGSDSVTYSNQCVLDC-LIKEGRSITVEKKGRC 68 >AE014134-2103|AAN10787.1| 68|Drosophila melanogaster CG31704-PA protein. Length = 68 Score = 38.7 bits (86), Expect = 0.002 Identities = 18/43 (41%), Positives = 22/43 (51%) Frame = +2 Query: 173 CICGKIYSPVCGSDGKTYENPCEFYCEKDKTHSNMTIVKNTGC 301 C C + Y PVCGSD TY N C C K ++T+ K C Sbjct: 27 CPCPRNYDPVCGSDSVTYSNQCVLDC-LIKEGRSITVEKKGRC 68 >AY075472-1|AAL68284.1| 692|Drosophila melanogaster RE32029p protein. Length = 692 Score = 35.1 bits (77), Expect = 0.025 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +2 Query: 173 CICGKI-YSPVCGSDGKTYENPCEFYCEKDKTHSNMTIVKNTGC 301 C C + Y P+CG DG Y +PC C +++ +++ N C Sbjct: 484 CGCSRTNYDPICGVDGVMYYSPCYAGCVQEEHANSLKRYHNCSC 527 >AE014134-1125|AAG22419.2| 692|Drosophila melanogaster CG31634-PA protein. Length = 692 Score = 35.1 bits (77), Expect = 0.025 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +2 Query: 173 CICGKI-YSPVCGSDGKTYENPCEFYCEKDKTHSNMTIVKNTGC 301 C C + Y P+CG DG Y +PC C +++ +++ N C Sbjct: 484 CGCSRTNYDPICGVDGVMYYSPCYAGCVQEEHANSLKRYHNCSC 527 >AY052138-1|AAK93562.1| 1071|Drosophila melanogaster SD09502p protein. Length = 1071 Score = 34.7 bits (76), Expect = 0.033 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = +2 Query: 152 TALPPPLCICGKIYSPVCGSDGKTYENPCEFYC 250 T+LP C C Y PVCGS+G TY + C C Sbjct: 723 TSLP---CNCPAHYVPVCGSNGNTYPSACVAKC 752 >AE014296-2453|AAF49684.2| 1071|Drosophila melanogaster CG5392-PA protein. Length = 1071 Score = 34.7 bits (76), Expect = 0.033 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = +2 Query: 152 TALPPPLCICGKIYSPVCGSDGKTYENPCEFYC 250 T+LP C C Y PVCGS+G TY + C C Sbjct: 723 TSLP---CNCPAHYVPVCGSNGNTYPSACVAKC 752 >AE014134-1648|AAS64665.1| 1136|Drosophila melanogaster CG3811-PD, isoform D protein. Length = 1136 Score = 33.1 bits (72), Expect = 0.099 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = +2 Query: 173 CICGKIYSPVCGSDGKTYENPCEFYCEKDKTHSNMTIVKNTGC 301 C+ ++ PVCG++G TY +PC C + SN T N C Sbjct: 582 CLTSEV-EPVCGNNGLTYFSPCHAGCTAFSSTSN-TNYTNCAC 622 >AE014134-1647|AAS64664.1| 1197|Drosophila melanogaster CG3811-PC, isoform C protein. Length = 1197 Score = 33.1 bits (72), Expect = 0.099 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = +2 Query: 173 CICGKIYSPVCGSDGKTYENPCEFYCEKDKTHSNMTIVKNTGC 301 C+ ++ PVCG++G TY +PC C + SN T N C Sbjct: 643 CLTSEV-EPVCGNNGLTYFSPCHAGCTAFSSTSN-TNYTNCAC 683 >AE014134-1646|AAN10695.1| 1197|Drosophila melanogaster CG3811-PB, isoform B protein. Length = 1197 Score = 33.1 bits (72), Expect = 0.099 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = +2 Query: 173 CICGKIYSPVCGSDGKTYENPCEFYCEKDKTHSNMTIVKNTGC 301 C+ ++ PVCG++G TY +PC C + SN T N C Sbjct: 643 CLTSEV-EPVCGNNGLTYFSPCHAGCTAFSSTSN-TNYTNCAC 683 >AE014134-1645|AAF52781.2| 1197|Drosophila melanogaster CG3811-PA, isoform A protein. Length = 1197 Score = 33.1 bits (72), Expect = 0.099 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = +2 Query: 173 CICGKIYSPVCGSDGKTYENPCEFYCEKDKTHSNMTIVKNTGC 301 C+ ++ PVCG++G TY +PC C + SN T N C Sbjct: 643 CLTSEV-EPVCGNNGLTYFSPCHAGCTAFSSTSN-TNYTNCAC 683 >BT023942-1|ABB36446.1| 789|Drosophila melanogaster LP09443p protein. Length = 789 Score = 32.3 bits (70), Expect = 0.17 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +2 Query: 173 CICGKI-YSPVCGSDGKTYENPCEFYCEK 256 C C + YSPVCG + TY + C C+K Sbjct: 544 CSCDYVRYSPVCGENNMTYISACHAGCKK 572 >AY047504-1|AAK77236.1| 698|Drosophila melanogaster GH01304p protein. Length = 698 Score = 32.3 bits (70), Expect = 0.17 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +2 Query: 173 CICGKI-YSPVCGSDGKTYENPCEFYCEK 256 C C + YSPVCG + TY + C C+K Sbjct: 453 CSCDYVRYSPVCGENNMTYISACHAGCKK 481 >AE013599-3367|AAF46826.1| 789|Drosophila melanogaster CG3380-PA protein. Length = 789 Score = 32.3 bits (70), Expect = 0.17 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +2 Query: 173 CICGKI-YSPVCGSDGKTYENPCEFYCEK 256 C C + YSPVCG + TY + C C+K Sbjct: 544 CSCDYVRYSPVCGENNMTYISACHAGCKK 572 >AE014134-2105|AAF53126.1| 77|Drosophila melanogaster CG14933-PA protein. Length = 77 Score = 31.9 bits (69), Expect = 0.23 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +2 Query: 200 VCGSDGKTYENPCEFYCEK 256 VCGS+G T++N CEF C + Sbjct: 37 VCGSNGVTFKNRCEFECSQ 55 >BT030425-1|ABO52845.1| 684|Drosophila melanogaster IP17768p protein. Length = 684 Score = 31.5 bits (68), Expect = 0.30 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = +2 Query: 173 CICGKI-YSPVCGSDGKTYENPCEFYC-EKDKTHSNMTIVKNTGCE 304 C C + Y+PVC +D T+ + C C E+ K TI TGCE Sbjct: 468 CHCDYVHYAPVCSADNITFISACHAGCSERTKDALGRTIY--TGCE 511 >AE013599-3365|AAF46824.2| 631|Drosophila melanogaster CG30277-PA protein. Length = 631 Score = 31.5 bits (68), Expect = 0.30 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = +2 Query: 173 CICGKI-YSPVCGSDGKTYENPCEFYC-EKDKTHSNMTIVKNTGCE 304 C C + Y+PVC +D T+ + C C E+ K TI TGCE Sbjct: 468 CHCDYVHYAPVCSADNITFISACHAGCSERTKDALGRTIY--TGCE 511 >BT003621-1|AAO39624.1| 767|Drosophila melanogaster GH04473p protein. Length = 767 Score = 29.9 bits (64), Expect = 0.93 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +2 Query: 194 SPVCGSDGKTYENPCE 241 +PVCG+DG+TY C+ Sbjct: 568 NPVCGTDGRTYNTECQ 583 Score = 27.1 bits (57), Expect = 6.5 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 Query: 200 VCGSDGKTYENPCE 241 VCG DGKTY + C+ Sbjct: 654 VCGVDGKTYRSACD 667 >AF454393-1|AAL51006.1| 705|Drosophila melanogaster follistatin protein. Length = 705 Score = 29.9 bits (64), Expect = 0.93 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +2 Query: 194 SPVCGSDGKTYENPCE 241 +PVCG+DG+TY C+ Sbjct: 506 NPVCGTDGRTYNTECQ 521 Score = 27.1 bits (57), Expect = 6.5 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 Query: 200 VCGSDGKTYENPCE 241 VCG DGKTY + C+ Sbjct: 592 VCGVDGKTYRSACD 605 >AE014297-408|AAF51914.1| 730|Drosophila melanogaster CG1077-PA protein. Length = 730 Score = 29.9 bits (64), Expect = 0.93 Identities = 17/54 (31%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Frame = +2 Query: 149 VTALPPPLCICGKIYSPVCGSDG---KTYENPCEFYCEKDKTHSNMTIVKNTGC 301 ++ PP C +IY PVC T+ N C E K+ N IV C Sbjct: 140 ISEKPPVPVPCTRIYRPVCAMYAGVKSTFSNECLVNAENIKSQRNWRIVSEGLC 193 >AE013599-2026|AAF58158.2| 767|Drosophila melanogaster CG33466-PA protein. Length = 767 Score = 29.9 bits (64), Expect = 0.93 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +2 Query: 194 SPVCGSDGKTYENPCE 241 +PVCG+DG+TY C+ Sbjct: 568 NPVCGTDGRTYNTECQ 583 Score = 27.1 bits (57), Expect = 6.5 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 Query: 200 VCGSDGKTYENPCE 241 VCG DGKTY + C+ Sbjct: 654 VCGVDGKTYRSACD 667 >AY069042-1|AAL39187.1| 114|Drosophila melanogaster GH03839p protein. Length = 114 Score = 29.5 bits (63), Expect = 1.2 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 173 CICGKIYSPVCGSDGKTYENPCEFYC 250 C Y+P+CGSD Y N +F C Sbjct: 71 CPATSEYNPICGSDNVNYYNENKFNC 96 >AE014298-1831|AAF48217.1| 843|Drosophila melanogaster CG15721-PA protein. Length = 843 Score = 29.5 bits (63), Expect = 1.2 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 2/50 (4%) Frame = +2 Query: 206 GSDGKTYENPCEFYCEKDKTHSNMTIVKNTGCEV--GIPCYCTLEYAPVC 349 G+ T+ +PCE + T N I+ CE P C +Y PVC Sbjct: 57 GAQPSTFPSPCEVQRFRALTGINWEIIHENRCETLEVCPDNCQDQYNPVC 106 >AE014296-51|AAF47354.2| 98|Drosophila melanogaster CG1220-PG, isoform G protein. Length = 98 Score = 29.5 bits (63), Expect = 1.2 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 173 CICGKIYSPVCGSDGKTYENPCEFYC 250 C Y+P+CGSD Y N +F C Sbjct: 54 CPATSEYNPICGSDNVNYYNENKFNC 79 >AE014296-50|AAN11429.1| 97|Drosophila melanogaster CG1220-PC, isoform C protein. Length = 97 Score = 29.5 bits (63), Expect = 1.2 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 173 CICGKIYSPVCGSDGKTYENPCEFYC 250 C Y+P+CGSD Y N +F C Sbjct: 54 CPATSEYNPICGSDNVNYYNENKFNC 79 >AE014296-49|AAN11428.1| 115|Drosophila melanogaster CG1220-PH, isoform H protein. Length = 115 Score = 29.5 bits (63), Expect = 1.2 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 173 CICGKIYSPVCGSDGKTYENPCEFYC 250 C Y+P+CGSD Y N +F C Sbjct: 71 CPATSEYNPICGSDNVNYYNENKFNC 96 >AE014296-48|AAN11427.1| 114|Drosophila melanogaster CG1220-PF, isoform F protein. Length = 114 Score = 29.5 bits (63), Expect = 1.2 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 173 CICGKIYSPVCGSDGKTYENPCEFYC 250 C Y+P+CGSD Y N +F C Sbjct: 71 CPATSEYNPICGSDNVNYYNENKFNC 96 >AE014296-47|AAG22218.2| 114|Drosophila melanogaster CG1220-PE, isoform E protein. Length = 114 Score = 29.5 bits (63), Expect = 1.2 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 173 CICGKIYSPVCGSDGKTYENPCEFYC 250 C Y+P+CGSD Y N +F C Sbjct: 71 CPATSEYNPICGSDNVNYYNENKFNC 96 >AE014296-46|AAF47353.1| 114|Drosophila melanogaster CG1220-PA, isoform A protein. Length = 114 Score = 29.5 bits (63), Expect = 1.2 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 173 CICGKIYSPVCGSDGKTYENPCEFYC 250 C Y+P+CGSD Y N +F C Sbjct: 71 CPATSEYNPICGSDNVNYYNENKFNC 96 >AB017976-1|BAA75790.1| 115|Drosophila melanogaster KAZ1-type serine protease inhibitor-like protein type epsilon protein. Length = 115 Score = 29.5 bits (63), Expect = 1.2 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 173 CICGKIYSPVCGSDGKTYENPCEFYC 250 C Y+P+CGSD Y N +F C Sbjct: 71 CPATSEYNPICGSDNVNYYNENKFNC 96 >AB017975-1|BAA75789.1| 97|Drosophila melanogaster KAZ1-type serine protease inhibitor-like protein type delta protein. Length = 97 Score = 29.5 bits (63), Expect = 1.2 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 173 CICGKIYSPVCGSDGKTYENPCEFYC 250 C Y+P+CGSD Y N +F C Sbjct: 54 CPATSEYNPICGSDNVNYYNENKFNC 79 >AB017974-1|BAA75788.1| 114|Drosophila melanogaster KAZ1-type serine protease inhibitor-like protein type gamma protein. Length = 114 Score = 29.5 bits (63), Expect = 1.2 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 173 CICGKIYSPVCGSDGKTYENPCEFYC 250 C Y+P+CGSD Y N +F C Sbjct: 71 CPATSEYNPICGSDNVNYYNENKFNC 96 >AB017973-1|BAA75787.1| 114|Drosophila melanogaster KAZ1-type serine protease inhibitor-like protein type gamma protein. Length = 114 Score = 29.5 bits (63), Expect = 1.2 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 173 CICGKIYSPVCGSDGKTYENPCEFYC 250 C Y+P+CGSD Y N +F C Sbjct: 71 CPATSEYNPICGSDNVNYYNENKFNC 96 >AB017972-1|BAA75786.1| 114|Drosophila melanogaster KAZ1-type serine protease inhibitor-like protein type gamma protein. Length = 114 Score = 29.5 bits (63), Expect = 1.2 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 173 CICGKIYSPVCGSDGKTYENPCEFYC 250 C Y+P+CGSD Y N +F C Sbjct: 71 CPATSEYNPICGSDNVNYYNENKFNC 96 >AB017699-2|BAA75687.1| 98|Drosophila melanogaster protease inhibitor-like protein protein. Length = 98 Score = 29.5 bits (63), Expect = 1.2 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 173 CICGKIYSPVCGSDGKTYENPCEFYC 250 C Y+P+CGSD Y N +F C Sbjct: 54 CPATSEYNPICGSDNVNYYNENKFNC 79 >AY906258-1|AAX60604.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906257-1|AAX60603.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906256-1|AAX60602.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906255-1|AAX60601.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906254-1|AAX60600.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906253-1|AAX60599.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906252-1|AAX60598.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906251-1|AAX60597.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906250-1|AAX60596.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906249-1|AAX60595.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906248-1|AAX60594.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906247-1|AAX60593.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906246-1|AAX60592.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906245-1|AAX60591.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906244-1|AAX60590.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906243-1|AAX60589.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906242-1|AAX60588.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906241-1|AAX60587.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906240-1|AAX60586.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906239-1|AAX60585.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906238-1|AAX60584.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906237-1|AAX60583.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906236-1|AAX60582.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906235-1|AAX60581.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906234-1|AAX60580.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906233-1|AAX60579.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906232-1|AAX60578.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906231-1|AAX60577.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906230-1|AAX60576.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906229-1|AAX60575.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906228-1|AAX60574.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906227-1|AAX60573.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906226-1|AAX60572.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906225-1|AAX60571.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906224-1|AAX60570.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906223-1|AAX60569.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906222-1|AAX60568.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906221-1|AAX60567.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906220-1|AAX60566.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906219-1|AAX60565.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906218-1|AAX60564.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906217-1|AAX60563.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906216-1|AAX60562.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906215-1|AAX60561.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906214-1|AAX60560.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906213-1|AAX60559.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906212-1|AAX60558.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906211-1|AAX60557.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906210-1|AAX60556.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906209-1|AAX60555.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906208-1|AAX60554.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906207-1|AAX60553.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906206-1|AAX60552.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906205-1|AAX60551.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906204-1|AAX60550.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906203-1|AAX60549.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906202-1|AAX60548.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906201-1|AAX60547.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906200-1|AAX60546.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906199-1|AAX60545.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906198-1|AAX60544.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906197-1|AAX60543.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906196-1|AAX60542.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906195-1|AAX60541.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906194-1|AAX60540.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906193-1|AAX60539.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906192-1|AAX60538.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906191-1|AAX60537.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906190-1|AAX60536.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906189-1|AAX60535.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906188-1|AAX60534.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906187-1|AAX60533.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906186-1|AAX60532.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906185-1|AAX60531.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906184-1|AAX60530.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906183-1|AAX60529.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906182-1|AAX60528.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906181-1|AAX60527.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906180-1|AAX60526.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906179-1|AAX60525.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906178-1|AAX60524.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906177-1|AAX60523.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906176-1|AAX60522.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906175-1|AAX60521.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906174-1|AAX60520.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906173-1|AAX60519.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906172-1|AAX60518.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906171-1|AAX60517.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906170-1|AAX60516.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906169-1|AAX60515.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906168-1|AAX60514.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906167-1|AAX60513.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906166-1|AAX60512.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906165-1|AAX60511.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906164-1|AAX60510.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906163-1|AAX60509.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906162-1|AAX60508.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906161-1|AAX60507.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906160-1|AAX60506.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906159-1|AAX60505.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906158-1|AAX60504.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906157-1|AAX60503.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906156-1|AAX60502.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906155-1|AAX60501.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906154-1|AAX60500.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906153-1|AAX60499.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906152-1|AAX60498.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906151-1|AAX60497.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906150-1|AAX60496.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906149-1|AAX60495.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906148-1|AAX60494.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906147-1|AAX60493.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906146-1|AAX60492.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906145-1|AAX60491.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906144-1|AAX60490.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906143-1|AAX60489.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906142-1|AAX60488.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906141-1|AAX60487.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906140-1|AAX60486.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906139-1|AAX60485.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906138-1|AAX60484.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906137-1|AAX60483.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906136-1|AAX60482.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906135-1|AAX60481.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906134-1|AAX60480.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906133-1|AAX60479.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906132-1|AAX60478.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906131-1|AAX60477.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906130-1|AAX60476.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906129-1|AAX60475.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906128-1|AAX60474.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906127-1|AAX60473.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906126-1|AAX60472.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906125-1|AAX60471.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906124-1|AAX60470.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906123-1|AAX60469.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906122-1|AAX60468.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906121-1|AAX60467.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906120-1|AAX60466.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906119-1|AAX60465.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906118-1|AAX60464.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906117-1|AAX60463.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906116-1|AAX60462.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906115-1|AAX60461.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906114-1|AAX60460.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906113-1|AAX60459.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906112-1|AAX60458.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906111-1|AAX60457.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906110-1|AAX60456.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906109-1|AAX60455.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906108-1|AAX60454.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906107-1|AAX60453.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906106-1|AAX60452.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906105-1|AAX60451.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906104-1|AAX60450.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906103-1|AAX60449.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906102-1|AAX60448.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906101-1|AAX60447.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906100-1|AAX60446.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906099-1|AAX60445.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906098-1|AAX60444.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906096-1|AAX60442.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906095-1|AAX60441.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906094-1|AAX60440.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906093-1|AAX60439.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906092-1|AAX60438.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906091-1|AAX60437.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906090-1|AAX60436.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906089-1|AAX60435.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906088-1|AAX60434.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906087-1|AAX60433.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906086-1|AAX60432.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906085-1|AAX60431.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906084-1|AAX60430.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906083-1|AAX60429.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906082-1|AAX60428.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906081-1|AAX60427.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906080-1|AAX60426.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906079-1|AAX60425.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906078-1|AAX60424.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906077-1|AAX60423.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906076-1|AAX60422.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906075-1|AAX60421.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906074-1|AAX60420.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906073-1|AAX60419.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906072-1|AAX60418.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906071-1|AAX60417.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906070-1|AAX60416.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906069-1|AAX60415.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906068-1|AAX60414.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906067-1|AAX60413.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906066-1|AAX60412.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906065-1|AAX60411.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906064-1|AAX60410.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906063-1|AAX60409.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906062-1|AAX60408.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906061-1|AAX60407.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906060-1|AAX60406.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906059-1|AAX60405.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906058-1|AAX60404.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906057-1|AAX60403.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906056-1|AAX60402.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906055-1|AAX60401.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906054-1|AAX60400.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906053-1|AAX60399.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906052-1|AAX60398.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906051-1|AAX60397.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906050-1|AAX60396.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906049-1|AAX60395.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906048-1|AAX60394.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906047-1|AAX60393.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906046-1|AAX60392.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906045-1|AAX60391.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 179 CGKIYSPVCGSDGKTYE 229 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,140,793 Number of Sequences: 53049 Number of extensions: 332740 Number of successful extensions: 1395 Number of sequences better than 10.0: 437 Number of HSP's better than 10.0 without gapping: 1339 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1395 length of database: 24,988,368 effective HSP length: 76 effective length of database: 20,956,644 effective search space used: 817309116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -