BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_K15 (698 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 2.4 AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 21 7.3 AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory recept... 21 9.7 AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory recept... 21 9.7 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 23.0 bits (47), Expect = 2.4 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 268 TLRFHHFYITVLLCTRFYIYKVFFLSLP*LFWDQIIYF 381 T F++ +I +LLC ++ Y ++ LF I YF Sbjct: 100 TYYFYYAFI-ILLCVYYFYYAFIIFTVHLLFLLCIYYF 136 Score = 23.0 bits (47), Expect = 2.4 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +1 Query: 289 YITVLLCTRFYIYKVFFLSLP*LFWDQIIYFT 384 ++ LLC +++ +FFL F+ I FT Sbjct: 126 HLLFLLCIYYFVVPLFFLLCIYYFYCAFIIFT 157 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 21.4 bits (43), Expect = 7.3 Identities = 7/31 (22%), Positives = 19/31 (61%) Frame = -3 Query: 177 LFHLWINIYVCIVRTINNYNHSIVYISASVL 85 L +++N++ ++ ++NY + + + SVL Sbjct: 97 LIFIFVNVFFWVIILMSNYAFTRIILLKSVL 127 >AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory receptor candidate 56 protein. Length = 358 Score = 21.0 bits (42), Expect = 9.7 Identities = 14/56 (25%), Positives = 26/56 (46%), Gaps = 3/56 (5%) Frame = +1 Query: 277 FHHFYITVLLCTRFYIYKVFFLSLP*LFWDQIIYFTRTFGSRNV---TNLKYYFNL 435 + H Y+ +L+ + V L++ +F+ Y T+T+ V L Y+ NL Sbjct: 137 YKHLYVNILIHLSGLVTIVATLTVTIIFFASYQYGTKTYSLFIVFMTVILPYFINL 192 >AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory receptor candidate 21 protein. Length = 386 Score = 21.0 bits (42), Expect = 9.7 Identities = 14/56 (25%), Positives = 26/56 (46%), Gaps = 3/56 (5%) Frame = +1 Query: 277 FHHFYITVLLCTRFYIYKVFFLSLP*LFWDQIIYFTRTFGSRNV---TNLKYYFNL 435 + H Y+ +L+ + V L++ +F+ Y T+T+ V L Y+ NL Sbjct: 137 YKHLYVNILIHLSGLVTIVATLTVTIIFFASYQYGTKTYSLFIVFMTVILPYFINL 192 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,381 Number of Sequences: 336 Number of extensions: 3193 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -