BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_K15 (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25066| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_27409| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00046) 29 4.8 SB_28271| Best HMM Match : 7tm_1 (HMM E-Value=6.2e-14) 28 6.3 >SB_25066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1167 Score = 29.5 bits (63), Expect = 2.7 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = -3 Query: 210 NFLTQLTNK*SLFHLWINIYVCIVRTINNYNHSIVYISASVLFYISL 70 N +T+L + L +N+Y C +NNY S ++AS FY SL Sbjct: 805 NAITELVSDKELSGDTVNLYTCF---LNNYYASTRTVTASTYFYPSL 848 >SB_27409| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00046) Length = 240 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +3 Query: 78 YKIIHLH*YKQLNDYNYLLFELYIHIYLSI 167 Y+ +H+H Y Y+YL L+IH Y+SI Sbjct: 153 YQRLHIHDYISTTPYSYL--RLHIHDYISI 180 >SB_28271| Best HMM Match : 7tm_1 (HMM E-Value=6.2e-14) Length = 686 Score = 28.3 bits (60), Expect = 6.3 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +3 Query: 288 LHYSTFMYTILYL*GFFFIFTVI-ILGSNNLFYSHFWQSKCY 410 L ++T +Y + + F I +V+ ILG FY H WQ+ Y Sbjct: 114 LKFNTAVYIAVSIWLFGIIVSVLPILGGIEYFYDHSWQAGFY 155 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,997,100 Number of Sequences: 59808 Number of extensions: 270834 Number of successful extensions: 467 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 422 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 462 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -