BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_K10 (564 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 6.9 AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled ... 23 9.1 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.0 bits (47), Expect = 6.9 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = +1 Query: 145 EYLNRPVKLVIIQHTDTPQCLTNDACAARVRSIQDYHMDTLKYW 276 E L R KL+II + D PQ + +R+ D K+W Sbjct: 1156 EVLKRRRKLIIILYGDLPQRDLDADMRLYLRTNTCIEWDDKKFW 1199 >AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled receptor 4 protein. Length = 426 Score = 22.6 bits (46), Expect = 9.1 Identities = 9/31 (29%), Positives = 14/31 (45%) Frame = -2 Query: 395 ITVILRAFLLYA*VGTLTCTQPDPSYTFAFP 303 + + +RAF LY L C D + +P Sbjct: 152 VFLFMRAFCLYLSSNVLVCVSLDRCFAVIYP 182 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 650,858 Number of Sequences: 2352 Number of extensions: 14456 Number of successful extensions: 34 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52983882 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -