BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_K07 (574 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3C7.04 |||transcription factor |Schizosaccharomyces pombe|ch... 28 1.1 SPAC9.12c |atp12||F1-ATPase chaperone Atp12 |Schizosaccharomyces... 26 4.5 SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pomb... 25 6.0 SPAC29A4.16 |hal4|sat4, ppk10|halotolerence protein 4|Schizosacc... 25 7.9 >SPAC3C7.04 |||transcription factor |Schizosaccharomyces pombe|chr 1|||Manual Length = 783 Score = 27.9 bits (59), Expect = 1.1 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -2 Query: 354 CYKVFDQGYQWPLVVCVLLHC 292 CY FD Y + + VLLHC Sbjct: 585 CYSFFDYNYTFSSALVVLLHC 605 >SPAC9.12c |atp12||F1-ATPase chaperone Atp12 |Schizosaccharomyces pombe|chr 1|||Manual Length = 287 Score = 25.8 bits (54), Expect = 4.5 Identities = 10/38 (26%), Positives = 17/38 (44%) Frame = +3 Query: 255 RCGVNNGHLDSDYNVVGHRQLMATDSPGRKLYNIIRRW 368 + GV +LD D ++ H+Q T R + + W Sbjct: 168 KLGVQLSYLDGDAGIIAHKQTQETHERIRNWLSSLNSW 205 >SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pombe|chr 2|||Manual Length = 2386 Score = 25.4 bits (53), Expect = 6.0 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -1 Query: 496 NILWHIKFCITINIHHPSSIHHLQIE**PYYS 401 NI K+CI N+ PS++ H + E YYS Sbjct: 440 NICTFAKWCINNNLDEPSNLKHFR-EMLDYYS 470 >SPAC29A4.16 |hal4|sat4, ppk10|halotolerence protein 4|Schizosaccharomyces pombe|chr 1|||Manual Length = 636 Score = 25.0 bits (52), Expect = 7.9 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = -1 Query: 478 KFCITINIHHPSSIHHLQI 422 +FCI+ ++ HP+ IH L + Sbjct: 405 EFCISSSLRHPNVIHTLDL 423 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,389,166 Number of Sequences: 5004 Number of extensions: 49465 Number of successful extensions: 106 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 106 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 244081442 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -