BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_K07 (574 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0901 + 12267042-12267182,12267949-12268095,12268163-122682... 29 2.6 09_04_0300 - 16488358-16488447,16488684-16489116,16489377-164896... 29 3.5 10_02_0136 + 5719136-5719780,5719923-5720237 27 8.0 06_03_0846 - 25328224-25330613,25330716-25330794 27 8.0 >03_02_0901 + 12267042-12267182,12267949-12268095,12268163-12268253, 12268367-12268485,12268779-12268969,12269440-12269650, 12270072-12270309,12270944-12271329,12271933-12271956, 12271984-12272077,12272341-12272525,12273025-12273255, 12273665-12273730,12273816-12274034,12274764-12275003, 12275244-12275423,12276269-12276535,12276612-12276815, 12276896-12277048 Length = 1128 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = +3 Query: 57 DTLKYWDIGSAFLIGGNAKVYEGSGWVHVSVPTHAYNRKALR 182 + ++Y+D L+GG E +G++ S+ H ++RK L+ Sbjct: 754 ELVEYFDPCHPILVGGIGLGEENTGYMQASLKRHRWHRKVLK 795 >09_04_0300 - 16488358-16488447,16488684-16489116,16489377-16489642, 16490015-16490044,16490282-16490606,16491752-16492035, 16492154-16492376,16493117-16493173,16494454-16494947 Length = 733 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -3 Query: 248 RFQCVDLFCCWLVGVVIS 195 R+ CVD CCWLVG V S Sbjct: 63 RWSCVDS-CCWLVGCVCS 79 >10_02_0136 + 5719136-5719780,5719923-5720237 Length = 319 Score = 27.5 bits (58), Expect = 8.0 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 Query: 395 AVNIFEPFGPPSDYVIKFSTRAISGH 318 AV+I EPFG YV ++ R + GH Sbjct: 152 AVDIPEPFGRRPAYVSNWAMRCVDGH 177 >06_03_0846 - 25328224-25330613,25330716-25330794 Length = 822 Score = 27.5 bits (58), Expect = 8.0 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 354 IIRRWPEWLENVDSYKE 404 II+RW W VD++KE Sbjct: 640 IIQRWMRWFSEVDNFKE 656 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,147,707 Number of Sequences: 37544 Number of extensions: 319177 Number of successful extensions: 644 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 633 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 644 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1328870592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -