BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_K07 (574 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 5.0 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 6.6 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 8.7 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 8.7 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.8 bits (44), Expect = 5.0 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +3 Query: 282 DSDYNVVGHRQLMATDSPGRKLYNIIRRWP 371 DSDY + + + S RKL NI+ P Sbjct: 201 DSDYTDKSNEKKIPKSSGWRKLRNIVHWTP 230 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.4 bits (43), Expect = 6.6 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -3 Query: 425 NRIVTILLFIAVNIF 381 +RIV L F+A+N+F Sbjct: 427 SRIVFPLFFLAINVF 441 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.0 bits (42), Expect = 8.7 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = +3 Query: 138 HVSVPTHAYNRKALRITVIGNYNSHQPTAEQIDALK 245 H+++ + A+RI + Y+SH E + LK Sbjct: 503 HITINADKPMKAAIRIFIGPKYDSHHKLIEIPEDLK 538 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.0 bits (42), Expect = 8.7 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = +3 Query: 138 HVSVPTHAYNRKALRITVIGNYNSHQPTAEQIDALK 245 H+++ + A+RI + Y+SH E + LK Sbjct: 503 HITINADKPMKAAIRIFIGPKYDSHHKLIEIPEDLK 538 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,220 Number of Sequences: 438 Number of extensions: 4036 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16504155 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -