BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_K06 (560 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1840.05c |||phosphomannomutase |Schizosaccharomyces pombe|ch... 29 0.62 SPBC947.06c |||spermidine family transporter |Schizosaccharomyce... 25 5.8 SPBC16A3.13 |meu7|aah4|alpha-amylase homolog Aah4|Schizosaccharo... 25 7.6 >SPCC1840.05c |||phosphomannomutase |Schizosaccharomyces pombe|chr 3|||Manual Length = 587 Score = 28.7 bits (61), Expect = 0.62 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -2 Query: 208 LSFSQ*NSHGFSYVLPSDPQTGL*IFPQIHNGGGRAVT 95 L++ Q +++G SYVL +DP F + NG R T Sbjct: 289 LAYEQADANGISYVLATDPDADRFAFAEKINGAWRRFT 326 >SPBC947.06c |||spermidine family transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 498 Score = 25.4 bits (53), Expect = 5.8 Identities = 11/35 (31%), Positives = 14/35 (40%) Frame = +1 Query: 241 PHARWASPATVPWNMPPSVALTEKLTPTNVHWNAP 345 P R V W MP + + N+HW AP Sbjct: 364 PEQRLPLMMAVGWLMPAGIFVFAWTNSPNIHWIAP 398 >SPBC16A3.13 |meu7|aah4|alpha-amylase homolog Aah4|Schizosaccharomyces pombe|chr 2|||Manual Length = 774 Score = 25.0 bits (52), Expect = 7.6 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 7/29 (24%) Frame = +2 Query: 224 DNREKHRMRGGHPLLLY-------LGICP 289 DNR+ +R G P++LY +G+CP Sbjct: 697 DNRQVFMVRNGEPMILYPEESAYEMGLCP 725 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,512,834 Number of Sequences: 5004 Number of extensions: 56277 Number of successful extensions: 141 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 135 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 141 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 236012634 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -