BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_K05 (629 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 27 0.13 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 22 3.7 AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 22 3.7 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 22 3.7 EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglu... 22 4.9 U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. 21 6.4 AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain tran... 21 6.4 AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. 21 6.4 AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 21 8.5 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 8.5 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 8.5 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 8.5 AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 21 8.5 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 27.1 bits (57), Expect = 0.13 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +2 Query: 245 TSTLSVPEWTTCSRTRLVHLRPPLTPMSLIVMTTLW 352 +ST + P WTT + R RP T + TT W Sbjct: 1044 SSTTTSPWWTTTTTRRTTTTRPTTTSTTTRPTTTNW 1079 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 22.2 bits (45), Expect = 3.7 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 248 STLSVPEWTTCSRTRLVHLRPPLTP 322 ++ SVPE T + R RPP TP Sbjct: 395 NSYSVPEPTISTTPRPEWARPPSTP 419 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 22.2 bits (45), Expect = 3.7 Identities = 8/44 (18%), Positives = 21/44 (47%) Frame = -3 Query: 291 LVLEHVVHSGTDSVEVRNLRNIWQVFSGECFGTEIVVVVMEEIY 160 L LEH +++ +++ + V EC+ ++ + +I+ Sbjct: 235 LFLEHYEVINRQTLDTADVKTLTTVVEKECYKMKVTIDAFNDIF 278 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 22.2 bits (45), Expect = 3.7 Identities = 8/44 (18%), Positives = 21/44 (47%) Frame = -3 Query: 291 LVLEHVVHSGTDSVEVRNLRNIWQVFSGECFGTEIVVVVMEEIY 160 L LEH +++ +++ + V EC+ ++ + +I+ Sbjct: 161 LFLEHYEVINRQTLDTADVKTLTTVVEKECYKMKVTIDAFNDIF 204 >EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglucosaminidase NAG1 protein. Length = 598 Score = 21.8 bits (44), Expect = 4.9 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 148 AAGKVNLFHNDNHDFSAKAFATKNLPNI 231 AA K+N FH D + F ++LP++ Sbjct: 235 AASKLNSFHWHITDSHSFPFTAESLPDL 262 >U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. Length = 322 Score = 21.4 bits (43), Expect = 6.4 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +3 Query: 87 ERTRSDPHKNSYPWV 131 E + S+P N YPW+ Sbjct: 158 ENSVSEPPANFYPWM 172 >AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain transcription factor Fushitarazu protein. Length = 290 Score = 21.4 bits (43), Expect = 6.4 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +3 Query: 87 ERTRSDPHKNSYPWV 131 E + S+P N YPW+ Sbjct: 158 ENSVSEPPANFYPWM 172 >AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. Length = 290 Score = 21.4 bits (43), Expect = 6.4 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +3 Query: 87 ERTRSDPHKNSYPWV 131 E + S+P N YPW+ Sbjct: 158 ENSVSEPPANFYPWM 172 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 21.0 bits (42), Expect = 8.5 Identities = 6/12 (50%), Positives = 6/12 (50%) Frame = +3 Query: 294 WCICDRRSHRCL 329 W C R H CL Sbjct: 61 WEFCQRNGHNCL 72 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.0 bits (42), Expect = 8.5 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +2 Query: 314 LTPMSLIVMTTLWGEN*IS 370 L P+S+I+++ W EN +S Sbjct: 12 LIPVSVILISVGWWENFVS 30 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 8.5 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +2 Query: 314 LTPMSLIVMTTLWGEN*IS 370 L P+S+I+++ W EN +S Sbjct: 245 LIPVSVILISVGWWENFVS 263 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 8.5 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +2 Query: 314 LTPMSLIVMTTLWGEN*IS 370 L P+S+I+++ W EN +S Sbjct: 245 LIPVSVILISVGWWENFVS 263 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 21.0 bits (42), Expect = 8.5 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = -3 Query: 483 EIFGKRETSAGFPRGLNERRIELLPTGVEVQRCGRSLEE 367 +IF ++T+ L + +L+P + CGR +EE Sbjct: 215 DIFYYKDTAQLVSLALLMQLTQLVPALFVIYLCGRVMEE 253 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,139 Number of Sequences: 336 Number of extensions: 3045 Number of successful extensions: 22 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16188355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -