BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_K03 (498 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL032628-1|CAA21555.1| 218|Caenorhabditis elegans Hypothetical ... 31 0.46 AL032625-5|CAH60795.1| 498|Caenorhabditis elegans Hypothetical ... 28 3.3 AL032625-3|CAB63349.1| 514|Caenorhabditis elegans Hypothetical ... 28 3.3 Z72508-7|CAA96642.1| 336|Caenorhabditis elegans Hypothetical pr... 27 10.0 AF067945-15|AAC17678.2| 286|Caenorhabditis elegans Serpentine r... 27 10.0 >AL032628-1|CAA21555.1| 218|Caenorhabditis elegans Hypothetical protein Y38H6A.1 protein. Length = 218 Score = 31.1 bits (67), Expect = 0.46 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = +3 Query: 174 ALYYACAHKHVLSLFRFMDYQTTTMLKKFIRFLKISLLTRV 296 A YACA K+ + Y+ T++ KF RFL + +++ Sbjct: 168 AKQYACAIKYAPQVVTVTGYKCATVIDKFFRFLSFFIFSQI 208 >AL032625-5|CAH60795.1| 498|Caenorhabditis elegans Hypothetical protein Y37H9A.1b protein. Length = 498 Score = 28.3 bits (60), Expect = 3.3 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = -3 Query: 172 WEKASQPEAALALVAPVCNQYSGAFSRRAVKMEYFSYIFKRKFG 41 W + + AL+ V ++YS FS + + YFS +F+ +G Sbjct: 148 WLEFQKSPRYSALLQRVLSKYSPDFSENSTILAYFSVLFEMDYG 191 >AL032625-3|CAB63349.1| 514|Caenorhabditis elegans Hypothetical protein Y37H9A.1a protein. Length = 514 Score = 28.3 bits (60), Expect = 3.3 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = -3 Query: 172 WEKASQPEAALALVAPVCNQYSGAFSRRAVKMEYFSYIFKRKFG 41 W + + AL+ V ++YS FS + + YFS +F+ +G Sbjct: 148 WLEFQKSPRYSALLQRVLSKYSPDFSENSTILAYFSVLFEMDYG 191 >Z72508-7|CAA96642.1| 336|Caenorhabditis elegans Hypothetical protein F28H7.11 protein. Length = 336 Score = 26.6 bits (56), Expect = 10.0 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = -2 Query: 245 RCGLIVHETKKRQYVFVRACVVQSLGKGITTRGGFSPC 132 R G++ TK++Q ++A +VQ++ I FSPC Sbjct: 230 RAGIMSESTKRQQNQLMKALIVQTITPTIAC---FSPC 264 >AF067945-15|AAC17678.2| 286|Caenorhabditis elegans Serpentine receptor, class x protein16 protein. Length = 286 Score = 26.6 bits (56), Expect = 10.0 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -3 Query: 373 IVFCHYNSK*SNWLVFNLLKKKCVRFT 293 IV CH+ ++W + L KKC R T Sbjct: 141 IVACHFKYDDASWSLAFLPSKKCTRLT 167 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,852,606 Number of Sequences: 27780 Number of extensions: 214371 Number of successful extensions: 467 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 462 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 467 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 945973702 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -