BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_K01 (584 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 24 3.2 CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoy... 23 7.3 AM182454-1|CAJ65692.1| 182|Anopheles gambiae globin 2 protein. 23 7.3 AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein p... 23 9.6 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +3 Query: 252 LQHCRCRSGLHVQGQDW 302 L HC+ R HV ++W Sbjct: 960 LPHCKIRDNPHVSAEEW 976 >CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoylCoA deltaisomerase protein. Length = 324 Score = 23.0 bits (47), Expect = 7.3 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 193 RGCRYGRDLLCRQPSFCHR 137 + CR+GR+L PSF R Sbjct: 5 KSCRFGRNLAKSIPSFLSR 23 >AM182454-1|CAJ65692.1| 182|Anopheles gambiae globin 2 protein. Length = 182 Score = 23.0 bits (47), Expect = 7.3 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 253 FNTVGAGVDYMFKDKIGASAT 315 F VGA ++Y FKD + AT Sbjct: 72 FKAVGALIEYGFKDPVLFDAT 92 >AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein protein. Length = 499 Score = 22.6 bits (46), Expect = 9.6 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -3 Query: 426 ELLPTGVEVQRCGRSLKEIQFSPQRVVVTIK 334 ELL + +R ++L+E+Q P +T K Sbjct: 154 ELLTMKLRAERAEKALREVQSEPPETPMTGK 184 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 604,181 Number of Sequences: 2352 Number of extensions: 13330 Number of successful extensions: 16 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55927431 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -