BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_K01 (584 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC093660-1|AAH93660.1| 931|Homo sapiens transient receptor pote... 29 9.1 BC093658-1|AAH93658.1| 931|Homo sapiens transient receptor pote... 29 9.1 AJ271068-1|CAC01686.1| 876|Homo sapiens transient receptor pote... 29 9.1 AJ271067-1|CAC01685.1| 815|Homo sapiens transient receptor pote... 29 9.1 AJ271066-1|CAC01684.1| 931|Homo sapiens transient receptor pote... 29 9.1 AJ006276-1|CAA06943.1| 931|Homo sapiens transient receptor pote... 29 9.1 AF080394-1|AAC63289.2| 931|Homo sapiens transient receptor pote... 29 9.1 AB058756-1|BAB47482.1| 708|Homo sapiens KIAA1853 protein protein. 29 9.1 >BC093660-1|AAH93660.1| 931|Homo sapiens transient receptor potential cation channel, subfamily C, member 6 protein. Length = 931 Score = 29.5 bits (63), Expect = 9.1 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 7/53 (13%) Frame = -1 Query: 488 KYLENEKL-VLGSHEDL------MKGVSNFFQPALKSSDVVGVLKRFSFPPRE 351 K E +KL +LGSHEDL K V + QP+++SS+ L F+ PPR+ Sbjct: 803 KINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRSSEDFH-LNSFNNPPRQ 854 >BC093658-1|AAH93658.1| 931|Homo sapiens transient receptor potential cation channel, subfamily C, member 6 protein. Length = 931 Score = 29.5 bits (63), Expect = 9.1 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 7/53 (13%) Frame = -1 Query: 488 KYLENEKL-VLGSHEDL------MKGVSNFFQPALKSSDVVGVLKRFSFPPRE 351 K E +KL +LGSHEDL K V + QP+++SS+ L F+ PPR+ Sbjct: 803 KINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRSSEDFH-LNSFNNPPRQ 854 >AJ271068-1|CAC01686.1| 876|Homo sapiens transient receptor potential channel 6, variant delta377-431 protein. Length = 876 Score = 29.5 bits (63), Expect = 9.1 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 7/53 (13%) Frame = -1 Query: 488 KYLENEKL-VLGSHEDL------MKGVSNFFQPALKSSDVVGVLKRFSFPPRE 351 K E +KL +LGSHEDL K V + QP+++SS+ L F+ PPR+ Sbjct: 748 KINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRSSEDFH-LNSFNNPPRQ 799 >AJ271067-1|CAC01685.1| 815|Homo sapiens transient receptor potential channel 6, variant delta316-431 protein. Length = 815 Score = 29.5 bits (63), Expect = 9.1 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 7/53 (13%) Frame = -1 Query: 488 KYLENEKL-VLGSHEDL------MKGVSNFFQPALKSSDVVGVLKRFSFPPRE 351 K E +KL +LGSHEDL K V + QP+++SS+ L F+ PPR+ Sbjct: 687 KINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRSSEDFH-LNSFNNPPRQ 738 >AJ271066-1|CAC01684.1| 931|Homo sapiens transient receptor potential channel 6 protein. Length = 931 Score = 29.5 bits (63), Expect = 9.1 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 7/53 (13%) Frame = -1 Query: 488 KYLENEKL-VLGSHEDL------MKGVSNFFQPALKSSDVVGVLKRFSFPPRE 351 K E +KL +LGSHEDL K V + QP+++SS+ L F+ PPR+ Sbjct: 803 KINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRSSEDFH-LNSFNNPPRQ 854 >AJ006276-1|CAA06943.1| 931|Homo sapiens transient receptor potential protein protein. Length = 931 Score = 29.5 bits (63), Expect = 9.1 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 7/53 (13%) Frame = -1 Query: 488 KYLENEKL-VLGSHEDL------MKGVSNFFQPALKSSDVVGVLKRFSFPPRE 351 K E +KL +LGSHEDL K V + QP+++SS+ L F+ PPR+ Sbjct: 803 KINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRSSEDFH-LNSFNNPPRQ 854 >AF080394-1|AAC63289.2| 931|Homo sapiens transient receptor potential protein 6 protein. Length = 931 Score = 29.5 bits (63), Expect = 9.1 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 7/53 (13%) Frame = -1 Query: 488 KYLENEKL-VLGSHEDL------MKGVSNFFQPALKSSDVVGVLKRFSFPPRE 351 K E +KL +LGSHEDL K V + QP+++SS+ L F+ PPR+ Sbjct: 803 KINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRSSEDFH-LNSFNNPPRQ 854 >AB058756-1|BAB47482.1| 708|Homo sapiens KIAA1853 protein protein. Length = 708 Score = 29.5 bits (63), Expect = 9.1 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -2 Query: 358 PESSRYDQRHRCERRSQMHQSCP*TCSPLRHR 263 P S + HRC RSQ +S P +C RHR Sbjct: 274 PRKSHRHRHHRCPSRSQSSESRPSSCES-RHR 304 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,382,234 Number of Sequences: 237096 Number of extensions: 1871016 Number of successful extensions: 3517 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 3434 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3517 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 6098631048 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -