BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_J24 (544 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146758-1|AAO12073.1| 289|Anopheles gambiae odorant-binding pr... 27 0.53 AJ618930-1|CAF02010.2| 273|Anopheles gambiae odorant-binding pr... 27 0.53 AF393485-1|AAL60410.1| 289|Anopheles gambiae odorant binding pr... 27 0.53 AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. 23 6.5 AM182454-1|CAJ65692.1| 182|Anopheles gambiae globin 2 protein. 23 6.5 >AY146758-1|AAO12073.1| 289|Anopheles gambiae odorant-binding protein AgamOBP30 protein. Length = 289 Score = 26.6 bits (56), Expect = 0.53 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +3 Query: 165 YSSSSELQHCRCRSGLHVQR*NWCICDRRTHRCL*PQRL 281 ++ + +Q RS H N C +RRT+RCL QRL Sbjct: 97 WNDTHGVQEASMRSFFHPDP-NDCDYERRTYRCLHSQRL 134 >AJ618930-1|CAF02010.2| 273|Anopheles gambiae odorant-binding protein OBPjj83c protein. Length = 273 Score = 26.6 bits (56), Expect = 0.53 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +3 Query: 165 YSSSSELQHCRCRSGLHVQR*NWCICDRRTHRCL*PQRL 281 ++ + +Q RS H N C +RRT+RCL QRL Sbjct: 81 WNDTHGVQEASMRSFFHPDP-NDCDYERRTYRCLHSQRL 118 >AF393485-1|AAL60410.1| 289|Anopheles gambiae odorant binding protein 1 protein. Length = 289 Score = 26.6 bits (56), Expect = 0.53 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +3 Query: 165 YSSSSELQHCRCRSGLHVQR*NWCICDRRTHRCL*PQRL 281 ++ + +Q RS H N C +RRT+RCL QRL Sbjct: 97 WNDTHGVQEASMRSFFHPDP-NDCDYERRTYRCLHSQRL 134 >AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. Length = 438 Score = 23.0 bits (47), Expect = 6.5 Identities = 12/50 (24%), Positives = 22/50 (44%) Frame = -1 Query: 523 IKLKVYYXLCTKTYNSINILKLIFYKSQLKYC*FKSTLKKKNWCWVPTRT 374 + LK + T+ N+ I + K L YC + ++ + W+P T Sbjct: 3 VTLKGCFTNPTECNNTECIDTTTYAKKNLNYCCCRGSMCNREHKWIPEAT 52 >AM182454-1|CAJ65692.1| 182|Anopheles gambiae globin 2 protein. Length = 182 Score = 23.0 bits (47), Expect = 6.5 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 184 FNTVGAGVDYMFKDKIGASAT 246 F VGA ++Y FKD + AT Sbjct: 72 FKAVGALIEYGFKDPVLFDAT 92 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 555,601 Number of Sequences: 2352 Number of extensions: 11074 Number of successful extensions: 20 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50040333 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -