BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_J22 (478 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8793| Best HMM Match : C1_1 (HMM E-Value=0.21) 28 4.5 SB_45897| Best HMM Match : Peptidase_C50 (HMM E-Value=2.7e-08) 27 7.9 >SB_8793| Best HMM Match : C1_1 (HMM E-Value=0.21) Length = 260 Score = 27.9 bits (59), Expect = 4.5 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = +1 Query: 76 ILNVCRAM*RFNCRYKL**QTNMARKSRLQCHPIEEKS*RSFLFGSWAT 222 +LNVCR F + N AR +L+ HP+ S SFL + T Sbjct: 73 LLNVCRKFPFFLFHW----HPNKARFEQLENHPVHHPSHESFLIAQYLT 117 >SB_45897| Best HMM Match : Peptidase_C50 (HMM E-Value=2.7e-08) Length = 1907 Score = 27.1 bits (57), Expect = 7.9 Identities = 14/53 (26%), Positives = 27/53 (50%) Frame = -1 Query: 439 TYNKSRYVNIFFNKFNLLMCCLLYVNFYLEV*SGASFTL*LYINVGKSNTSCS 281 TYNK + + + K+ LL CL+ + E S ++ ++ L ++ + CS Sbjct: 576 TYNKQKVLEVA-TKYQLLSDCLVRTQSFPEALSSSTISVMLLLSAAEYPEECS 627 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,927,609 Number of Sequences: 59808 Number of extensions: 277024 Number of successful extensions: 631 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 599 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 631 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 989515521 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -