BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_J19 (563 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC17G9.05 |rct1|cyp6|RRM-containing cyclophilin regulating tra... 25 5.8 SPAC4F10.13c |mpd2||GYF domain|Schizosaccharomyces pombe|chr 1||... 25 5.8 SPAC589.12 ||SPAC688.01|glycosylceramide biosynthesis protein |S... 25 5.8 SPAC30C2.04 |||cofactor for methionyl-and glutamyl-tRNA syntheta... 25 7.7 >SPBC17G9.05 |rct1|cyp6|RRM-containing cyclophilin regulating transcription Rct1|Schizosaccharomyces pombe|chr 2|||Manual Length = 432 Score = 25.4 bits (53), Expect = 5.8 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +2 Query: 203 SMHGDDAKFTRQSYG*FEILGHRDEFRRR 289 S DD ++ R+S G ++ +RD++R R Sbjct: 340 SSRSDDREYHRRSDGRYDRSNYRDDYRHR 368 >SPAC4F10.13c |mpd2||GYF domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 992 Score = 25.4 bits (53), Expect = 5.8 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -3 Query: 321 IQNLRKLSRCHLRRNSSRCPNISNYP 244 + NL S+ LRR SR P SN P Sbjct: 283 VDNLADFSQSPLRRGPSRFPTNSNVP 308 >SPAC589.12 ||SPAC688.01|glycosylceramide biosynthesis protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 971 Score = 25.4 bits (53), Expect = 5.8 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +3 Query: 30 IYTIFTIFLSWKSVRADCGVVSKKDWGGLSPVHIEY 137 I+T + + S+ S+R K WGG V+I Y Sbjct: 564 IFTSYVLIYSFASIRISSFYSPAKVWGGAFLVYILY 599 >SPAC30C2.04 |||cofactor for methionyl-and glutamyl-tRNA synthetases |Schizosaccharomyces pombe|chr 1|||Manual Length = 450 Score = 25.0 bits (52), Expect = 7.7 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 436 HCCSAE*NRVI*LLIIKWLGIDQFSPRKVLDV 531 HC AE R + ++K++ ++Q RKV+ V Sbjct: 307 HCGDAEGPRTVCSGLVKYIPLEQMQQRKVIVV 338 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,511,200 Number of Sequences: 5004 Number of extensions: 52430 Number of successful extensions: 142 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 139 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 142 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 238029836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -