BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_J19 (563 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0407 - 3613417-3613506,3613603-3613713,3613789-3613857,361... 31 0.48 10_05_0040 - 8463585-8464396,8464664-8465273,8465708-8466169 30 1.5 02_04_0645 + 24703102-24704598 30 1.5 04_01_0446 - 5815231-5816202 29 1.9 03_06_0140 + 31951569-31951710,31951943-31952037,31952141-319539... 29 2.6 11_04_0260 - 15509658-15509780,15510092-15510161,15510265-155104... 29 3.4 04_04_0470 + 25474029-25475525 29 3.4 05_03_0618 - 16262826-16263097,16263111-16263183 28 4.5 02_04_0646 + 24710348-24711838 28 4.5 06_03_0905 + 25843547-25844314 28 5.9 03_05_0585 + 25869955-25869984,25870092-25870182,25870402-258705... 28 5.9 01_06_1682 - 39130696-39131705,39132355-39132583 28 5.9 11_01_0315 - 2347254-2347345,2347485-2347895,2348182-2349633,234... 27 7.8 10_08_0936 - 21679002-21679800,21679893-21680116,21681174-216813... 27 7.8 09_02_0414 - 8825575-8826654,8826737-8827144 27 7.8 05_04_0235 + 19291204-19291769,19291860-19292250 27 7.8 >08_01_0407 - 3613417-3613506,3613603-3613713,3613789-3613857, 3613936-3614091,3614156-3614222,3614375-3614470, 3614976-3615142 Length = 251 Score = 31.5 bits (68), Expect = 0.48 Identities = 20/74 (27%), Positives = 38/74 (51%) Frame = +3 Query: 342 TIGYNRKSIGISFVGNYDNQEATNQQLEAVRSLLQCGVKQGHLTSNYKVVGHRPVLATES 521 T GY+RK +G+S+V + Q N + +R ++ ++ H S K+ G PV E+ Sbjct: 148 TRGYSRKDLGVSYV--KEKQLRVNMGISKLREKVKEHQEKFH--SAAKIAGSNPVEWMEN 203 Query: 522 PGRYLYNQIRRWPE 563 R++ + ++ E Sbjct: 204 ADRWIVGFLEKFEE 217 >10_05_0040 - 8463585-8464396,8464664-8465273,8465708-8466169 Length = 627 Score = 29.9 bits (64), Expect = 1.5 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 3/55 (5%) Frame = +3 Query: 102 DWGGLS-PVHIEYLPRPISLVIIQHTVTPTCETNEACMVTMRS--LQDNHMDNLK 257 +WG + P I +LP I LVI + T P N ++T+RS L +N + N++ Sbjct: 410 EWGSVCIPPDIVHLPHLIHLVIPEGTGLPDGIGNLKSLITLRSFDLGENSLHNIR 464 >02_04_0645 + 24703102-24704598 Length = 498 Score = 29.9 bits (64), Expect = 1.5 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = +1 Query: 316 LDGFTSERTRSVTTGNLSGSASSVTTTI-KRQRTSNWKL*DHC 441 +DG S R+ T +L+GS +++TT KR T +W + D C Sbjct: 271 IDGQWSAVGRTAVTTSLAGSVAALTTLYGKRWLTGHWNVTDVC 313 >04_01_0446 - 5815231-5816202 Length = 323 Score = 29.5 bits (63), Expect = 1.9 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +2 Query: 197 ERSMHGDDAKFTRQSYG*FEILGHRDEFRRRWQR-ESLRRFWM 322 +R GD ++R G + + RRRW+R ES+RR+WM Sbjct: 262 QRWSGGDGLGWSRSGSGAWRRWMGMEPERRRWKRAESMRRWWM 304 >03_06_0140 + 31951569-31951710,31951943-31952037,31952141-31953982, 31954065-31954179,31954260-31954897 Length = 943 Score = 29.1 bits (62), Expect = 2.6 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +3 Query: 189 CETNEACMVTMRSLQDNHMDNLKYWDIGMN 278 C M+ R +Q+NH D WD G N Sbjct: 868 CTAENLRMILHRDMQNNHPDANSMWDFGWN 897 >11_04_0260 - 15509658-15509780,15510092-15510161,15510265-15510438, 15511098-15511528 Length = 265 Score = 28.7 bits (61), Expect = 3.4 Identities = 20/74 (27%), Positives = 32/74 (43%), Gaps = 2/74 (2%) Frame = +3 Query: 138 LPRPISLVIIQHTVTPTCETNE-ACMVTMR-SLQDNHMDNLKYWDIGMNFVVGGNGKVYE 311 LP P L+++Q T+ + A V R S + +D+ Y + VGG G + Sbjct: 5 LPLPALLLVVQPTMAVASHGGDGAAFVAARPSSVHSSLDDSAYGILNDGEGVGGGGGGEQ 64 Query: 312 GSGWLHVGAHTIGY 353 G GW + + Y Sbjct: 65 GGGWANGSGYESRY 78 >04_04_0470 + 25474029-25475525 Length = 498 Score = 28.7 bits (61), Expect = 3.4 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = +1 Query: 316 LDGFTSERTRSVTTGNLSGSASSVTTTI-KRQRTSNWKL*DHC 441 ++G S R+ T L+GS +++TT KR +T +W + D C Sbjct: 269 INGQWSGVGRTAVTTTLAGSVAALTTLFGKRLQTGHWNVVDVC 311 >05_03_0618 - 16262826-16263097,16263111-16263183 Length = 114 Score = 28.3 bits (60), Expect = 4.5 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +2 Query: 287 RWQRESLRRFWMASRRSAHDR 349 RW R + RR W+ RRS H R Sbjct: 8 RWSRMARRRRWLKRRRSGHCR 28 >02_04_0646 + 24710348-24711838 Length = 496 Score = 28.3 bits (60), Expect = 4.5 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +1 Query: 343 RSVTTGNLSGSASSVTTTI-KRQRTSNWKL*DHC 441 R+ T L+GS +++TT KR +T +W + D C Sbjct: 278 RTAVTTTLAGSTAALTTLFGKRLQTGHWNVIDVC 311 >06_03_0905 + 25843547-25844314 Length = 255 Score = 27.9 bits (59), Expect = 5.9 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 349 PIVCAPT*SHPEPS*TFPLPPTT 281 P+V P ++P P T+P PP T Sbjct: 130 PVVVGPPVTYPTPPVTYPTPPVT 152 >03_05_0585 + 25869955-25869984,25870092-25870182,25870402-25870551, 25870687-25870774,25871096-25871590,25871755-25871890, 25872117-25872310,25872421-25872529,25872685-25872796, 25873260-25873339,25873503-25873607 Length = 529 Score = 27.9 bits (59), Expect = 5.9 Identities = 17/71 (23%), Positives = 35/71 (49%) Frame = +3 Query: 42 FTIFLSWKSVRADCGVVSKKDWGGLSPVHIEYLPRPISLVIIQHTVTPTCETNEACMVTM 221 + I LS++SV+A +V +W L + + + + + HT TPT T+ + + Sbjct: 405 YRIALSYRSVKA---LVEMHNWKQL--LEKDQAGKKGGFIFLPHTNTPTILTDTQATICV 459 Query: 222 RSLQDNHMDNL 254 R + H+ ++ Sbjct: 460 RMRSEEHLHDI 470 >01_06_1682 - 39130696-39131705,39132355-39132583 Length = 412 Score = 27.9 bits (59), Expect = 5.9 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 2/26 (7%) Frame = -2 Query: 325 SHPEPS*TF--PLPPTTKFIPMSQYF 254 +HP P + P+PPT K++P YF Sbjct: 257 NHPPPPYGYNSPIPPTNKYLPPPYYF 282 >11_01_0315 - 2347254-2347345,2347485-2347895,2348182-2349633, 2349688-2350045,2350818-2351177,2351321-2351419, 2351856-2351948,2352078-2352215,2352389-2352476, 2352682-2352770,2353113-2353178,2353370-2353481, 2354702-2354901 Length = 1185 Score = 27.5 bits (58), Expect = 7.8 Identities = 10/43 (23%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = -2 Query: 169 WIITRLIGRGKYSICTGDSPP--QSFLETTPQSARTLFQLKNI 47 W + R + + + +C GD P +S TP + +L+++ Sbjct: 668 WYVVRFVSKHNHPLCKGDQVPFLRSHRRITPAEQAKMVELRDV 710 >10_08_0936 - 21679002-21679800,21679893-21680116,21681174-21681361, 21681505-21682597 Length = 767 Score = 27.5 bits (58), Expect = 7.8 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +3 Query: 72 RADCGVVSKKDWGGLSPVHIEYLPRPISL 158 R++CG ++ ++GG +P P P+ L Sbjct: 265 RSECGFAARSEYGGTAPSEYAAAPLPLPL 293 >09_02_0414 - 8825575-8826654,8826737-8827144 Length = 495 Score = 27.5 bits (58), Expect = 7.8 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 325 SHPEPS*TFPLPPTTKFIPMSQYFKLSI 242 SHP + FP PP + P SQ F+ ++ Sbjct: 39 SHPAYAMNFPFPPFPHYPPYSQNFQYAV 66 >05_04_0235 + 19291204-19291769,19291860-19292250 Length = 318 Score = 27.5 bits (58), Expect = 7.8 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -3 Query: 327 EAIQNLRKLSRCHLRRNSSRCPNISNYPYDCLVNFASS 214 EA+ + + L RN + CP Y YD LV A++ Sbjct: 71 EAVVSKELFEQLLLHRNDAACPARGFYTYDALVTAAAA 108 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,743,569 Number of Sequences: 37544 Number of extensions: 367579 Number of successful extensions: 1003 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 958 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1002 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1293275844 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -