BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_J18 (406 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0406 - 2958933-2962076 26 9.9 >02_01_0406 - 2958933-2962076 Length = 1047 Score = 26.2 bits (55), Expect = 9.9 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = +1 Query: 34 NPDSFFFQPLNGPNVNYEAISSGPAFVDFNHPN 132 +P +F NGP+ Y ++ P ++ +H N Sbjct: 532 DPGAFELPVYNGPSFQYRTLTGFPTLLNLSHNN 564 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,932,803 Number of Sequences: 37544 Number of extensions: 174774 Number of successful extensions: 289 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 287 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 289 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 706675332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -